mirror of
https://github.com/biopython/biopython.git
synced 2025-11-12 06:54:30 +08:00
1946 lines
92 KiB
Python
1946 lines
92 KiB
Python
# Copyright 2007-2016 by Peter Cock. All rights reserved.
|
|
# Revisions copyright 2010 by Uri Laserson. All rights reserved.
|
|
# This code is part of the Biopython distribution and governed by its
|
|
# license. Please see the LICENSE file that should have been included
|
|
# as part of this package.
|
|
"""Internal code for parsing GenBank and EMBL files (PRIVATE).
|
|
|
|
This code is NOT intended for direct use. It provides a basic scanner
|
|
(for use with a event consumer such as Bio.GenBank._FeatureConsumer)
|
|
to parse a GenBank or EMBL file (with their shared INSDC feature table).
|
|
|
|
It is used by Bio.GenBank to parse GenBank files
|
|
It is also used by Bio.SeqIO to parse GenBank and EMBL files
|
|
|
|
Feature Table Documentation:
|
|
http://www.insdc.org/files/feature_table.html
|
|
http://www.ncbi.nlm.nih.gov/projects/collab/FT/index.html
|
|
ftp://ftp.ncbi.nih.gov/genbank/docs/
|
|
"""
|
|
# 17-MAR-2009: added wgs, wgs_scafld for GenBank whole genome shotgun master records.
|
|
# These are GenBank files that summarize the content of a project, and provide lists of
|
|
# scaffold and contig files in the project. These will be in annotations['wgs'] and
|
|
# annotations['wgs_scafld']. These GenBank files do not have sequences. See
|
|
# http://groups.google.com/group/bionet.molbio.genbank/browse_thread/thread/51fb88bf39e7dc36
|
|
# http://is.gd/nNgk
|
|
# for more details of this format, and an example.
|
|
# Added by Ying Huang & Iddo Friedberg
|
|
|
|
from __future__ import print_function
|
|
|
|
import warnings
|
|
import re
|
|
from collections import defaultdict
|
|
from Bio.Seq import Seq
|
|
from Bio.SeqRecord import SeqRecord
|
|
from Bio.Alphabet import generic_protein
|
|
from Bio import BiopythonParserWarning
|
|
|
|
|
|
class InsdcScanner(object):
|
|
"""Basic functions for breaking up a GenBank/EMBL file into sub sections.
|
|
|
|
The International Nucleotide Sequence Database Collaboration (INSDC)
|
|
between the DDBJ, EMBL, and GenBank. These organisations all use the
|
|
same "Feature Table" layout in their plain text flat file formats.
|
|
|
|
However, the header and sequence sections of an EMBL file are very
|
|
different in layout to those produced by GenBank/DDBJ."""
|
|
|
|
# These constants get redefined with sensible values in the sub classes:
|
|
RECORD_START = "XXX" # "LOCUS " or "ID "
|
|
HEADER_WIDTH = 3 # 12 or 5
|
|
FEATURE_START_MARKERS = ["XXX***FEATURES***XXX"]
|
|
FEATURE_END_MARKERS = ["XXX***END FEATURES***XXX"]
|
|
FEATURE_QUALIFIER_INDENT = 0
|
|
FEATURE_QUALIFIER_SPACER = ""
|
|
SEQUENCE_HEADERS = ["XXX"] # with right hand side spaces removed
|
|
|
|
def __init__(self, debug=0):
|
|
assert len(self.RECORD_START) == self.HEADER_WIDTH
|
|
for marker in self.SEQUENCE_HEADERS:
|
|
assert marker == marker.rstrip()
|
|
assert len(self.FEATURE_QUALIFIER_SPACER) == self.FEATURE_QUALIFIER_INDENT
|
|
self.debug = debug
|
|
self.line = None
|
|
|
|
def set_handle(self, handle):
|
|
self.handle = handle
|
|
self.line = ""
|
|
|
|
def find_start(self):
|
|
"""Read in lines until find the ID/LOCUS line, which is returned.
|
|
|
|
Any preamble (such as the header used by the NCBI on ``*.seq.gz`` archives)
|
|
will we ignored."""
|
|
while True:
|
|
if self.line:
|
|
line = self.line
|
|
self.line = ""
|
|
else:
|
|
line = self.handle.readline()
|
|
if not line:
|
|
if self.debug:
|
|
print("End of file")
|
|
return None
|
|
if line[:self.HEADER_WIDTH] == self.RECORD_START:
|
|
if self.debug > 1:
|
|
print("Found the start of a record:\n" + line)
|
|
break
|
|
line = line.rstrip()
|
|
if line == "//":
|
|
if self.debug > 1:
|
|
print("Skipping // marking end of last record")
|
|
elif line == "":
|
|
if self.debug > 1:
|
|
print("Skipping blank line before record")
|
|
else:
|
|
# Ignore any header before the first ID/LOCUS line.
|
|
if self.debug > 1:
|
|
print("Skipping header line before record:\n" + line)
|
|
self.line = line
|
|
return line
|
|
|
|
def parse_header(self):
|
|
"""Return list of strings making up the header
|
|
|
|
New line characters are removed.
|
|
|
|
Assumes you have just read in the ID/LOCUS line.
|
|
"""
|
|
assert self.line[:self.HEADER_WIDTH] == self.RECORD_START, \
|
|
"Not at start of record"
|
|
|
|
header_lines = []
|
|
while True:
|
|
line = self.handle.readline()
|
|
if not line:
|
|
raise ValueError("Premature end of line during sequence data")
|
|
line = line.rstrip()
|
|
if line in self.FEATURE_START_MARKERS:
|
|
if self.debug:
|
|
print("Found feature table")
|
|
break
|
|
# if line[:self.HEADER_WIDTH]==self.FEATURE_START_MARKER[:self.HEADER_WIDTH]:
|
|
# if self.debug : print("Found header table (?)")
|
|
# break
|
|
if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS:
|
|
if self.debug:
|
|
print("Found start of sequence")
|
|
break
|
|
if line == "//":
|
|
raise ValueError("Premature end of sequence data marker '//' found")
|
|
header_lines.append(line)
|
|
self.line = line
|
|
return header_lines
|
|
|
|
def parse_features(self, skip=False):
|
|
"""Return list of tuples for the features (if present)
|
|
|
|
Each feature is returned as a tuple (key, location, qualifiers)
|
|
where key and location are strings (e.g. "CDS" and
|
|
"complement(join(490883..490885,1..879))") while qualifiers
|
|
is a list of two string tuples (feature qualifier keys and values).
|
|
|
|
Assumes you have already read to the start of the features table.
|
|
"""
|
|
if self.line.rstrip() not in self.FEATURE_START_MARKERS:
|
|
if self.debug:
|
|
print("Didn't find any feature table")
|
|
return []
|
|
|
|
while self.line.rstrip() in self.FEATURE_START_MARKERS:
|
|
self.line = self.handle.readline()
|
|
|
|
features = []
|
|
line = self.line
|
|
while True:
|
|
if not line:
|
|
raise ValueError("Premature end of line during features table")
|
|
if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS:
|
|
if self.debug:
|
|
print("Found start of sequence")
|
|
break
|
|
line = line.rstrip()
|
|
if line == "//":
|
|
raise ValueError("Premature end of features table, marker '//' found")
|
|
if line in self.FEATURE_END_MARKERS:
|
|
if self.debug:
|
|
print("Found end of features")
|
|
line = self.handle.readline()
|
|
break
|
|
if line[2:self.FEATURE_QUALIFIER_INDENT].strip() == "":
|
|
# This is an empty feature line between qualifiers. Empty
|
|
# feature lines within qualifiers are handled below (ignored).
|
|
line = self.handle.readline()
|
|
continue
|
|
if len(line) < self.FEATURE_QUALIFIER_INDENT:
|
|
warnings.warn("line too short to contain a feature: %r" % line,
|
|
BiopythonParserWarning)
|
|
line = self.handle.readline()
|
|
continue
|
|
|
|
if skip:
|
|
line = self.handle.readline()
|
|
while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER:
|
|
line = self.handle.readline()
|
|
else:
|
|
# Build up a list of the lines making up this feature:
|
|
if line[self.FEATURE_QUALIFIER_INDENT] != " " \
|
|
and " " in line[self.FEATURE_QUALIFIER_INDENT:]:
|
|
# The feature table design enforces a length limit on the feature keys.
|
|
# Some third party files (e.g. IGMT's EMBL like files) solve this by
|
|
# over indenting the location and qualifiers.
|
|
feature_key, line = line[2:].strip().split(None, 1)
|
|
feature_lines = [line]
|
|
warnings.warn("Overindented %s feature?" % feature_key,
|
|
BiopythonParserWarning)
|
|
else:
|
|
feature_key = line[2:self.FEATURE_QUALIFIER_INDENT].strip()
|
|
feature_lines = [line[self.FEATURE_QUALIFIER_INDENT:]]
|
|
line = self.handle.readline()
|
|
while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER \
|
|
or (line != '' and line.rstrip() == ""): # cope with blank lines in the midst of a feature
|
|
# Use strip to remove any harmless trailing white space AND and leading
|
|
# white space (e.g. out of spec files with too much indentation)
|
|
feature_lines.append(line[self.FEATURE_QUALIFIER_INDENT:].strip())
|
|
line = self.handle.readline()
|
|
features.append(self.parse_feature(feature_key, feature_lines))
|
|
self.line = line
|
|
return features
|
|
|
|
def parse_feature(self, feature_key, lines):
|
|
r"""Expects a feature as a list of strings, returns a tuple (key, location, qualifiers)
|
|
|
|
For example given this GenBank feature::
|
|
|
|
CDS complement(join(490883..490885,1..879))
|
|
/locus_tag="NEQ001"
|
|
/note="conserved hypothetical [Methanococcus jannaschii];
|
|
COG1583:Uncharacterized ACR; IPR001472:Bipartite nuclear
|
|
localization signal; IPR002743: Protein of unknown
|
|
function DUF57"
|
|
/codon_start=1
|
|
/transl_table=11
|
|
/product="hypothetical protein"
|
|
/protein_id="NP_963295.1"
|
|
/db_xref="GI:41614797"
|
|
/db_xref="GeneID:2732620"
|
|
/translation="MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKK
|
|
EKYFNFTLIPKKDIIENKRYYLIISSPDKRFIEVLHNKIKDLDIITIGLAQFQLRKTK
|
|
KFDPKLRFPWVTITPIVLREGKIVILKGDKYYKVFVKRLEELKKYNLIKKKEPILEEP
|
|
IEISLNQIKDGWKIIDVKDRYYDFRNKSFSAFSNWLRDLKEQSLRKYNNFCGKNFYFE
|
|
EAIFEGFTFYKTVSIRIRINRGEAVYIGTLWKELNVYRKLDKEEREFYKFLYDCGLGS
|
|
LNSMGFGFVNTKKNSAR"
|
|
|
|
Then should give input key="CDS" and the rest of the data as a list of strings
|
|
lines=["complement(join(490883..490885,1..879))", ..., "LNSMGFGFVNTKKNSAR"]
|
|
where the leading spaces and trailing newlines have been removed.
|
|
|
|
Returns tuple containing: (key as string, location string, qualifiers as list)
|
|
as follows for this example:
|
|
|
|
key = "CDS", string
|
|
location = "complement(join(490883..490885,1..879))", string
|
|
qualifiers = list of string tuples:
|
|
|
|
[('locus_tag', '"NEQ001"'),
|
|
('note', '"conserved hypothetical [Methanococcus jannaschii];\nCOG1583:..."'),
|
|
('codon_start', '1'),
|
|
('transl_table', '11'),
|
|
('product', '"hypothetical protein"'),
|
|
('protein_id', '"NP_963295.1"'),
|
|
('db_xref', '"GI:41614797"'),
|
|
('db_xref', '"GeneID:2732620"'),
|
|
('translation', '"MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKK\nEKYFNFT..."')]
|
|
|
|
In the above example, the "note" and "translation" were edited for compactness,
|
|
and they would contain multiple new line characters (displayed above as \n)
|
|
|
|
If a qualifier is quoted (in this case, everything except codon_start and
|
|
transl_table) then the quotes are NOT removed.
|
|
|
|
Note that no whitespace is removed.
|
|
"""
|
|
# Skip any blank lines
|
|
iterator = (x for x in lines if x)
|
|
try:
|
|
line = next(iterator)
|
|
|
|
feature_location = line.strip()
|
|
while feature_location[-1:] == ",":
|
|
# Multiline location, still more to come!
|
|
line = next(iterator)
|
|
feature_location += line.strip()
|
|
if feature_location.count("(") > feature_location.count(")"):
|
|
# Including the prev line in warning would be more explicit,
|
|
# but this way get one-and-only-one warning shown by default:
|
|
warnings.warn("Non-standard feature line wrapping (didn't break on comma)?",
|
|
BiopythonParserWarning)
|
|
while feature_location[-1:] == "," or feature_location.count("(") > feature_location.count(")"):
|
|
line = next(iterator)
|
|
feature_location += line.strip()
|
|
|
|
qualifiers = []
|
|
|
|
for line_number, line in enumerate(iterator):
|
|
# check for extra wrapping of the location closing parentheses
|
|
if line_number == 0 and line.startswith(")"):
|
|
feature_location += line.strip()
|
|
elif line[0] == "/":
|
|
# New qualifier
|
|
i = line.find("=")
|
|
key = line[1:i] # does not work if i==-1
|
|
value = line[i + 1:] # we ignore 'value' if i==-1
|
|
if i == -1:
|
|
# Qualifier with no key, e.g. /pseudo
|
|
key = line[1:]
|
|
qualifiers.append((key, None))
|
|
elif not value:
|
|
# ApE can output /note=
|
|
qualifiers.append((key, ""))
|
|
elif value == '"':
|
|
# One single quote
|
|
if self.debug:
|
|
print("Single quote %s:%s" % (key, value))
|
|
# DO NOT remove the quote...
|
|
qualifiers.append((key, value))
|
|
elif value[0] == '"':
|
|
# Quoted...
|
|
value_list = [value]
|
|
while value_list[-1][-1] != '"':
|
|
value_list.append(next(iterator))
|
|
value = '\n'.join(value_list)
|
|
# DO NOT remove the quotes...
|
|
qualifiers.append((key, value))
|
|
else:
|
|
# Unquoted
|
|
# if debug : print("Unquoted line %s:%s" % (key,value))
|
|
qualifiers.append((key, value))
|
|
else:
|
|
# Unquoted continuation
|
|
assert len(qualifiers) > 0
|
|
assert key == qualifiers[-1][0]
|
|
# if debug : print("Unquoted Cont %s:%s" % (key, line))
|
|
if qualifiers[-1][1] is None:
|
|
raise StopIteration
|
|
qualifiers[-1] = (key, qualifiers[-1][1] + "\n" + line)
|
|
return (feature_key, feature_location, qualifiers)
|
|
except StopIteration:
|
|
# Bummer
|
|
raise ValueError("Problem with '%s' feature:\n%s"
|
|
% (feature_key, "\n".join(lines)))
|
|
|
|
def parse_footer(self):
|
|
"""returns a tuple containing a list of any misc strings, and the sequence"""
|
|
# This is a basic bit of code to scan and discard the sequence,
|
|
# which was useful when developing the sub classes.
|
|
if self.line in self.FEATURE_END_MARKERS:
|
|
while self.line[:self.HEADER_WIDTH].rstrip() not in self.SEQUENCE_HEADERS:
|
|
self.line = self.handle.readline()
|
|
if not self.line:
|
|
raise ValueError("Premature end of file")
|
|
self.line = self.line.rstrip()
|
|
|
|
assert self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS, \
|
|
"Not at start of sequence"
|
|
while True:
|
|
line = self.handle.readline()
|
|
if not line:
|
|
raise ValueError("Premature end of line during sequence data")
|
|
line = line.rstrip()
|
|
if line == "//":
|
|
break
|
|
self.line = line
|
|
return [], "" # Dummy values!
|
|
|
|
def _feed_first_line(self, consumer, line):
|
|
"""Handle the LOCUS/ID line, passing data to the comsumer
|
|
|
|
This should be implemented by the EMBL / GenBank specific subclass
|
|
|
|
Used by the parse_records() and parse() methods.
|
|
"""
|
|
pass
|
|
|
|
def _feed_header_lines(self, consumer, lines):
|
|
"""Handle the header lines (list of strings), passing data to the comsumer
|
|
|
|
This should be implemented by the EMBL / GenBank specific subclass
|
|
|
|
Used by the parse_records() and parse() methods.
|
|
"""
|
|
pass
|
|
|
|
@staticmethod
|
|
def _feed_feature_table(consumer, feature_tuples):
|
|
"""Handle the feature table (list of tuples), passing data to the comsumer
|
|
|
|
Used by the parse_records() and parse() methods.
|
|
"""
|
|
consumer.start_feature_table()
|
|
for feature_key, location_string, qualifiers in feature_tuples:
|
|
consumer.feature_key(feature_key)
|
|
consumer.location(location_string)
|
|
for q_key, q_value in qualifiers:
|
|
if q_value is None:
|
|
consumer.feature_qualifier(q_key, q_value)
|
|
else:
|
|
consumer.feature_qualifier(q_key, q_value.replace("\n", " "))
|
|
|
|
def _feed_misc_lines(self, consumer, lines):
|
|
"""Handle any lines between features and sequence (list of strings), passing data to the consumer
|
|
|
|
This should be implemented by the EMBL / GenBank specific subclass
|
|
|
|
Used by the parse_records() and parse() methods.
|
|
"""
|
|
pass
|
|
|
|
def feed(self, handle, consumer, do_features=True):
|
|
"""Feed a set of data into the consumer.
|
|
|
|
This method is intended for use with the "old" code in Bio.GenBank
|
|
|
|
Arguments:
|
|
|
|
- handle - A handle with the information to parse.
|
|
- consumer - The consumer that should be informed of events.
|
|
- do_features - Boolean, should the features be parsed?
|
|
Skipping the features can be much faster.
|
|
|
|
Return values:
|
|
|
|
- true - Passed a record
|
|
- false - Did not find a record
|
|
"""
|
|
# Should work with both EMBL and GenBank files provided the
|
|
# equivalent Bio.GenBank._FeatureConsumer methods are called...
|
|
self.set_handle(handle)
|
|
if not self.find_start():
|
|
# Could not find (another) record
|
|
consumer.data = None
|
|
return False
|
|
|
|
# We use the above class methods to parse the file into a simplified format.
|
|
# The first line, header lines and any misc lines after the features will be
|
|
# dealt with by GenBank / EMBL specific derived classes.
|
|
|
|
# First line and header:
|
|
self._feed_first_line(consumer, self.line)
|
|
self._feed_header_lines(consumer, self.parse_header())
|
|
|
|
# Features (common to both EMBL and GenBank):
|
|
if do_features:
|
|
self._feed_feature_table(consumer, self.parse_features(skip=False))
|
|
else:
|
|
self.parse_features(skip=True) # ignore the data
|
|
|
|
# Footer and sequence
|
|
misc_lines, sequence_string = self.parse_footer()
|
|
self._feed_misc_lines(consumer, misc_lines)
|
|
|
|
consumer.sequence(sequence_string)
|
|
# Calls to consumer.base_number() do nothing anyway
|
|
consumer.record_end("//")
|
|
|
|
assert self.line == "//"
|
|
|
|
# And we are done
|
|
return True
|
|
|
|
def parse(self, handle, do_features=True):
|
|
"""Returns a SeqRecord (with SeqFeatures if do_features=True)
|
|
|
|
See also the method parse_records() for use on multi-record files.
|
|
"""
|
|
from Bio.GenBank import _FeatureConsumer
|
|
from Bio.GenBank.utils import FeatureValueCleaner
|
|
|
|
consumer = _FeatureConsumer(use_fuzziness=1,
|
|
feature_cleaner=FeatureValueCleaner())
|
|
|
|
if self.feed(handle, consumer, do_features):
|
|
return consumer.data
|
|
else:
|
|
return None
|
|
|
|
def parse_records(self, handle, do_features=True):
|
|
"""Returns a SeqRecord object iterator
|
|
|
|
Each record (from the ID/LOCUS line to the // line) becomes a SeqRecord
|
|
|
|
The SeqRecord objects include SeqFeatures if do_features=True
|
|
|
|
This method is intended for use in Bio.SeqIO
|
|
"""
|
|
# This is a generator function
|
|
while True:
|
|
record = self.parse(handle, do_features)
|
|
if record is None:
|
|
break
|
|
if record.id is None:
|
|
raise ValueError("Failed to parse the record's ID. Invalid ID line?")
|
|
if record.name == "<unknown name>":
|
|
raise ValueError("Failed to parse the record's name. Invalid ID line?")
|
|
if record.description == "<unknown description>":
|
|
raise ValueError("Failed to parse the record's description")
|
|
yield record
|
|
|
|
def parse_cds_features(self, handle,
|
|
alphabet=generic_protein,
|
|
tags2id=('protein_id', 'locus_tag', 'product')):
|
|
"""Returns SeqRecord object iterator
|
|
|
|
Each CDS feature becomes a SeqRecord.
|
|
|
|
- alphabet - Used for any sequence found in a translation field.
|
|
- tags2id - Tupple of three strings, the feature keys to use
|
|
for the record id, name and description,
|
|
|
|
This method is intended for use in Bio.SeqIO
|
|
"""
|
|
self.set_handle(handle)
|
|
while self.find_start():
|
|
# Got an EMBL or GenBank record...
|
|
self.parse_header() # ignore header lines!
|
|
feature_tuples = self.parse_features()
|
|
# self.parse_footer() # ignore footer lines!
|
|
while True:
|
|
line = self.handle.readline()
|
|
if not line:
|
|
break
|
|
if line[:2] == "//":
|
|
break
|
|
self.line = line.rstrip()
|
|
|
|
# Now go though those features...
|
|
for key, location_string, qualifiers in feature_tuples:
|
|
if key == "CDS":
|
|
# Create SeqRecord
|
|
# ================
|
|
# SeqRecord objects cannot be created with annotations, they
|
|
# must be added afterwards. So create an empty record and
|
|
# then populate it:
|
|
record = SeqRecord(seq=None)
|
|
annotations = record.annotations
|
|
|
|
# Should we add a location object to the annotations?
|
|
# I *think* that only makes sense for SeqFeatures with their
|
|
# sub features...
|
|
annotations['raw_location'] = location_string.replace(' ', '')
|
|
|
|
for (qualifier_name, qualifier_data) in qualifiers:
|
|
if qualifier_data is not None \
|
|
and qualifier_data[0] == '"' and qualifier_data[-1] == '"':
|
|
# Remove quotes
|
|
qualifier_data = qualifier_data[1:-1]
|
|
# Append the data to the annotation qualifier...
|
|
if qualifier_name == "translation":
|
|
assert record.seq is None, "Multiple translations!"
|
|
record.seq = Seq(qualifier_data.replace("\n", ""), alphabet)
|
|
elif qualifier_name == "db_xref":
|
|
# its a list, possibly empty. Its safe to extend
|
|
record.dbxrefs.append(qualifier_data)
|
|
else:
|
|
if qualifier_data is not None:
|
|
qualifier_data = qualifier_data.replace("\n", " ").replace(" ", " ")
|
|
try:
|
|
annotations[qualifier_name] += " " + qualifier_data
|
|
except KeyError:
|
|
# Not an addition to existing data, its the first bit
|
|
annotations[qualifier_name] = qualifier_data
|
|
|
|
# Fill in the ID, Name, Description
|
|
# =================================
|
|
try:
|
|
record.id = annotations[tags2id[0]]
|
|
except KeyError:
|
|
pass
|
|
try:
|
|
record.name = annotations[tags2id[1]]
|
|
except KeyError:
|
|
pass
|
|
try:
|
|
record.description = annotations[tags2id[2]]
|
|
except KeyError:
|
|
pass
|
|
|
|
yield record
|
|
|
|
|
|
class EmblScanner(InsdcScanner):
|
|
"""For extracting chunks of information in EMBL files"""
|
|
|
|
RECORD_START = "ID "
|
|
HEADER_WIDTH = 5
|
|
FEATURE_START_MARKERS = ["FH Key Location/Qualifiers", "FH"]
|
|
FEATURE_END_MARKERS = ["XX"] # XX can also mark the end of many things!
|
|
FEATURE_QUALIFIER_INDENT = 21
|
|
FEATURE_QUALIFIER_SPACER = "FT" + " " * (FEATURE_QUALIFIER_INDENT - 2)
|
|
SEQUENCE_HEADERS = ["SQ", "CO"] # Remove trailing spaces
|
|
|
|
def parse_footer(self):
|
|
"""returns a tuple containing a list of any misc strings, and the sequence"""
|
|
assert self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS, \
|
|
"Eh? '%s'" % self.line
|
|
|
|
# Note that the SQ line can be split into several lines...
|
|
misc_lines = []
|
|
while self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS:
|
|
misc_lines.append(self.line)
|
|
self.line = self.handle.readline()
|
|
if not self.line:
|
|
raise ValueError("Premature end of file")
|
|
self.line = self.line.rstrip()
|
|
|
|
assert self.line[:self.HEADER_WIDTH] == " " * self.HEADER_WIDTH \
|
|
or self.line.strip() == '//', "Unexpected content after SQ or CO line: %r" % self.line
|
|
|
|
seq_lines = []
|
|
line = self.line
|
|
while True:
|
|
if not line:
|
|
raise ValueError("Premature end of file in sequence data")
|
|
line = line.strip()
|
|
if not line:
|
|
raise ValueError("Blank line in sequence data")
|
|
if line == '//':
|
|
break
|
|
assert self.line[:self.HEADER_WIDTH] == " " * self.HEADER_WIDTH, \
|
|
repr(self.line)
|
|
# Remove tailing number now, remove spaces later
|
|
linersplit = line.rsplit(None, 1)
|
|
if(len(linersplit) > 1):
|
|
seq_lines.append(linersplit[0])
|
|
line = self.handle.readline()
|
|
self.line = line
|
|
return (misc_lines, "".join(seq_lines).replace(" ", ""))
|
|
|
|
def _feed_first_line(self, consumer, line):
|
|
assert line[:self.HEADER_WIDTH].rstrip() == "ID"
|
|
if line[self.HEADER_WIDTH:].count(";") == 6:
|
|
# Looks like the semi colon separated style introduced in 2006
|
|
self._feed_first_line_new(consumer, line)
|
|
elif line[self.HEADER_WIDTH:].count(";") == 3:
|
|
if line.rstrip().endswith(" SQ"):
|
|
# EMBL-bank patent data
|
|
self._feed_first_line_patents(consumer, line)
|
|
else:
|
|
# Looks like the pre 2006 style
|
|
self._feed_first_line_old(consumer, line)
|
|
elif line[self.HEADER_WIDTH:].count(";") == 2:
|
|
# Looks like KIKO patent data
|
|
self._feed_first_line_patents_kipo(consumer, line)
|
|
else:
|
|
raise ValueError('Did not recognise the ID line layout:\n' + line)
|
|
|
|
def _feed_first_line_patents(self, consumer, line):
|
|
# Either Non-Redundant Level 1 database records,
|
|
# ID <accession>; <molecule type>; <non-redundant level 1>; <cluster size L1>
|
|
# e.g. ID NRP_AX000635; PRT; NR1; 15 SQ
|
|
#
|
|
# Or, Non-Redundant Level 2 database records:
|
|
# ID <L2-accession>; <molecule type>; <non-redundant level 2>; <cluster size L2>
|
|
# e.g. ID NRP0000016E; PRT; NR2; 5 SQ
|
|
# e.g. ID NRP_AX000635; PRT; NR1; 15 SQ
|
|
fields = [data.strip() for data in line[self.HEADER_WIDTH:].strip()[:-3].split(";")]
|
|
assert len(fields) == 4
|
|
consumer.locus(fields[0])
|
|
consumer.residue_type(fields[1])
|
|
consumer.data_file_division(fields[2])
|
|
# TODO - Record cluster size?
|
|
|
|
def _feed_first_line_patents_kipo(self, consumer, line):
|
|
# EMBL format patent sequence from KIPO, e.g.
|
|
# ftp://ftp.ebi.ac.uk/pub/databases/patentdata/kipo_prt.dat.gz
|
|
#
|
|
# e.g. ID DI500001 STANDARD; PRT; 111 AA.
|
|
#
|
|
# This follows the style of _feed_first_line_old
|
|
assert line[:self.HEADER_WIDTH].rstrip() == "ID"
|
|
fields = [line[self.HEADER_WIDTH:].split(None, 1)[0]]
|
|
fields.extend(line[self.HEADER_WIDTH:].split(None, 1)[1].split(";"))
|
|
fields = [entry.strip() for entry in fields]
|
|
"""
|
|
The tokens represent:
|
|
|
|
0. Primary accession number
|
|
(space sep)
|
|
1. ??? (e.g. standard)
|
|
(semi-colon)
|
|
2. Molecule type (protein)? Division? Always 'PRT'
|
|
3. Sequence length (e.g. '111 AA.')
|
|
"""
|
|
consumer.locus(fields[0]) # Should we also call the accession consumer?
|
|
self._feed_seq_length(consumer, fields[3])
|
|
|
|
def _feed_first_line_old(self, consumer, line):
|
|
# Expects an ID line in the style before 2006, e.g.
|
|
# ID SC10H5 standard; DNA; PRO; 4870 BP.
|
|
# ID BSUB9999 standard; circular DNA; PRO; 4214630 BP.
|
|
assert line[:self.HEADER_WIDTH].rstrip() == "ID"
|
|
fields = [line[self.HEADER_WIDTH:].split(None, 1)[0]]
|
|
fields.extend(line[self.HEADER_WIDTH:].split(None, 1)[1].split(";"))
|
|
fields = [entry.strip() for entry in fields]
|
|
"""
|
|
The tokens represent:
|
|
|
|
0. Primary accession number
|
|
(space sep)
|
|
1. ??? (e.g. standard)
|
|
(semi-colon)
|
|
2. Topology and/or Molecule type (e.g. 'circular DNA' or 'DNA')
|
|
3. Taxonomic division (e.g. 'PRO')
|
|
4. Sequence length (e.g. '4639675 BP.')
|
|
"""
|
|
consumer.locus(fields[0]) # Should we also call the accession consumer?
|
|
consumer.residue_type(fields[2])
|
|
if "circular" in fields[2]:
|
|
consumer.topology("circular")
|
|
elif "linear" in fields[2]:
|
|
consumer.topology("linear")
|
|
consumer.data_file_division(fields[3])
|
|
self._feed_seq_length(consumer, fields[4])
|
|
|
|
def _feed_first_line_new(self, consumer, line):
|
|
# Expects an ID line in the style introduced in 2006, e.g.
|
|
# ID X56734; SV 1; linear; mRNA; STD; PLN; 1859 BP.
|
|
# ID CD789012; SV 4; linear; genomic DNA; HTG; MAM; 500 BP.
|
|
assert line[:self.HEADER_WIDTH].rstrip() == "ID"
|
|
fields = [data.strip() for data in line[self.HEADER_WIDTH:].strip().split(";")]
|
|
assert len(fields) == 7
|
|
"""
|
|
The tokens represent:
|
|
|
|
0. Primary accession number
|
|
1. Sequence version number
|
|
2. Topology: 'circular' or 'linear'
|
|
3. Molecule type (e.g. 'genomic DNA')
|
|
4. Data class (e.g. 'STD')
|
|
5. Taxonomic division (e.g. 'PRO')
|
|
6. Sequence length (e.g. '4639675 BP.')
|
|
"""
|
|
|
|
consumer.locus(fields[0])
|
|
|
|
# Call the accession consumer now, to make sure we record
|
|
# something as the record.id, in case there is no AC line
|
|
consumer.accession(fields[0])
|
|
|
|
# TODO - How to deal with the version field? At the moment the consumer
|
|
# will try and use this for the ID which isn't ideal for EMBL files.
|
|
version_parts = fields[1].split()
|
|
if len(version_parts) == 2 \
|
|
and version_parts[0] == "SV" \
|
|
and version_parts[1].isdigit():
|
|
consumer.version_suffix(version_parts[1])
|
|
|
|
# Based on how the old GenBank parser worked, merge these two:
|
|
consumer.residue_type(" ".join(fields[2:4])) # TODO - Store as two fields?
|
|
|
|
consumer.topology(fields[2])
|
|
|
|
# consumer.xxx(fields[4]) # TODO - What should we do with the data class?
|
|
|
|
consumer.data_file_division(fields[5])
|
|
|
|
self._feed_seq_length(consumer, fields[6])
|
|
|
|
@staticmethod
|
|
def _feed_seq_length(consumer, text):
|
|
length_parts = text.split()
|
|
assert len(length_parts) == 2, "Invalid sequence length string %r" % text
|
|
assert length_parts[1].upper() in ["BP", "BP.", "AA", "AA."]
|
|
consumer.size(length_parts[0])
|
|
|
|
def _feed_header_lines(self, consumer, lines):
|
|
EMBL_INDENT = self.HEADER_WIDTH
|
|
EMBL_SPACER = " " * EMBL_INDENT
|
|
consumer_dict = {
|
|
'AC': 'accession',
|
|
'SV': 'version', # SV line removed in June 2006, now part of ID line
|
|
'DE': 'definition',
|
|
# 'RN' : 'reference_num',
|
|
# 'RC' : reference comment... TODO
|
|
# 'RP' : 'reference_bases',
|
|
# 'RX' : reference cross reference... DOI or Pubmed
|
|
'RG': 'consrtm', # optional consortium
|
|
# 'RA' : 'authors',
|
|
# 'RT' : 'title',
|
|
'RL': 'journal',
|
|
'OS': 'organism',
|
|
'OC': 'taxonomy',
|
|
# 'DR' : data reference
|
|
'CC': 'comment',
|
|
# 'XX' : splitter
|
|
}
|
|
# We have to handle the following specially:
|
|
# RX (depending on reference type...)
|
|
for line in lines:
|
|
line_type = line[:EMBL_INDENT].strip()
|
|
data = line[EMBL_INDENT:].strip()
|
|
if line_type == 'XX':
|
|
pass
|
|
elif line_type == 'RN':
|
|
# Reformat reference numbers for the GenBank based consumer
|
|
# e.g. '[1]' becomes '1'
|
|
if data[0] == "[" and data[-1] == "]":
|
|
data = data[1:-1]
|
|
consumer.reference_num(data)
|
|
elif line_type == 'RP':
|
|
if data.strip() == "[-]":
|
|
# Patent EMBL files from KIPO just use: RN [-]
|
|
pass
|
|
else:
|
|
# Reformat reference numbers for the GenBank based consumer
|
|
# e.g. '1-4639675' becomes '(bases 1 to 4639675)'
|
|
# and '160-550, 904-1055' becomes '(bases 160 to 550; 904 to 1055)'
|
|
# Note could be multi-line, and end with a comma
|
|
parts = [bases.replace("-", " to ").strip() for bases in data.split(",") if bases.strip()]
|
|
consumer.reference_bases("(bases %s)" % "; ".join(parts))
|
|
elif line_type == 'RT':
|
|
# Remove the enclosing quotes and trailing semi colon.
|
|
# Note the title can be split over multiple lines.
|
|
if data.startswith('"'):
|
|
data = data[1:]
|
|
if data.endswith('";'):
|
|
data = data[:-2]
|
|
consumer.title(data)
|
|
elif line_type == 'RX':
|
|
# EMBL support three reference types at the moment:
|
|
# - PUBMED PUBMED bibliographic database (NLM)
|
|
# - DOI Digital Object Identifier (International DOI Foundation)
|
|
# - AGRICOLA US National Agriculture Library (NAL) of the US Department
|
|
# of Agriculture (USDA)
|
|
#
|
|
# Format:
|
|
# RX resource_identifier; identifier.
|
|
#
|
|
# e.g.
|
|
# RX DOI; 10.1016/0024-3205(83)90010-3.
|
|
# RX PUBMED; 264242.
|
|
#
|
|
# Currently our reference object only supports PUBMED and MEDLINE
|
|
# (as these were in GenBank files?).
|
|
key, value = data.split(";", 1)
|
|
if value.endswith("."):
|
|
value = value[:-1]
|
|
value = value.strip()
|
|
if key == "PUBMED":
|
|
consumer.pubmed_id(value)
|
|
# TODO - Handle other reference types (here and in BioSQL bindings)
|
|
elif line_type == 'CC':
|
|
# Have to pass a list of strings for this one (not just a string)
|
|
consumer.comment([data])
|
|
elif line_type == 'DR':
|
|
# Database Cross-reference, format:
|
|
# DR database_identifier; primary_identifier; secondary_identifier.
|
|
#
|
|
# e.g.
|
|
# DR MGI; 98599; Tcrb-V4.
|
|
#
|
|
# TODO - How should we store any secondary identifier?
|
|
parts = data.rstrip(".").split(";")
|
|
# Turn it into "database_identifier:primary_identifier" to
|
|
# mimic the GenBank parser. e.g. "MGI:98599"
|
|
consumer.dblink("%s:%s" % (parts[0].strip(),
|
|
parts[1].strip()))
|
|
elif line_type == 'RA':
|
|
# Remove trailing ; at end of authors list
|
|
consumer.authors(data.rstrip(";"))
|
|
elif line_type == 'PR':
|
|
# In the EMBL patent files, this is a PR (PRiority) line which
|
|
# provides the earliest active priority within the family.
|
|
# The priority number comes first, followed by the priority date.
|
|
#
|
|
# e.g.
|
|
# PR JP19990377484 16-DEC-1999
|
|
#
|
|
# However, in most EMBL files this is a PR (PRoject) line which
|
|
# gives the BioProject reference number.
|
|
#
|
|
# e.g.
|
|
# PR Project:PRJNA60715;
|
|
#
|
|
# In GenBank files this corresponds to the old PROJECT line
|
|
# which was later replaced with the DBLINK line.
|
|
if data.startswith("Project:"):
|
|
# Remove trailing ; at end of the project reference
|
|
consumer.project(data.rstrip(";"))
|
|
elif line_type == 'KW':
|
|
consumer.keywords(data.rstrip(";"))
|
|
elif line_type in consumer_dict:
|
|
# Its a semi-automatic entry!
|
|
getattr(consumer, consumer_dict[line_type])(data)
|
|
else:
|
|
if self.debug:
|
|
print("Ignoring EMBL header line:\n%s" % line)
|
|
|
|
def _feed_misc_lines(self, consumer, lines):
|
|
# TODO - Should we do something with the information on the SQ line(s)?
|
|
lines.append("")
|
|
line_iter = iter(lines)
|
|
try:
|
|
for line in line_iter:
|
|
if line.startswith("CO "):
|
|
line = line[5:].strip()
|
|
contig_location = line
|
|
while True:
|
|
line = next(line_iter)
|
|
if not line:
|
|
break
|
|
elif line.startswith("CO "):
|
|
# Don't need to preseve the whitespace here.
|
|
contig_location += line[5:].strip()
|
|
else:
|
|
raise ValueError('Expected CO (contig) continuation line, got:\n' + line)
|
|
consumer.contig_location(contig_location)
|
|
if line.startswith("SQ Sequence "):
|
|
# e.g.
|
|
# SQ Sequence 219 BP; 82 A; 48 C; 33 G; 45 T; 11 other;
|
|
#
|
|
# Or, EMBL-bank patent, e.g.
|
|
# SQ Sequence 465 AA; 3963407aa91d3a0d622fec679a4524e0; MD5;
|
|
self._feed_seq_length(consumer, line[14:].rstrip().rstrip(";").split(";", 1)[0])
|
|
# TODO - Record the checksum etc?
|
|
return
|
|
except StopIteration:
|
|
raise ValueError("Problem in misc lines before sequence")
|
|
|
|
|
|
class _ImgtScanner(EmblScanner):
|
|
"""For extracting chunks of information in IMGT (EMBL like) files (PRIVATE).
|
|
|
|
IMGT files are like EMBL files but in order to allow longer feature types
|
|
the features should be indented by 25 characters not 21 characters. In
|
|
practice the IMGT flat files tend to use either 21 or 25 characters, so we
|
|
must cope with both.
|
|
|
|
This is private to encourage use of Bio.SeqIO rather than Bio.GenBank.
|
|
"""
|
|
|
|
FEATURE_START_MARKERS = ["FH Key Location/Qualifiers",
|
|
"FH Key Location/Qualifiers (from EMBL)",
|
|
"FH Key Location/Qualifiers",
|
|
"FH"]
|
|
|
|
def parse_features(self, skip=False):
|
|
"""Return list of tuples for the features (if present)
|
|
|
|
Each feature is returned as a tuple (key, location, qualifiers)
|
|
where key and location are strings (e.g. "CDS" and
|
|
"complement(join(490883..490885,1..879))") while qualifiers
|
|
is a list of two string tuples (feature qualifier keys and values).
|
|
|
|
Assumes you have already read to the start of the features table.
|
|
"""
|
|
if self.line.rstrip() not in self.FEATURE_START_MARKERS:
|
|
if self.debug:
|
|
print("Didn't find any feature table")
|
|
return []
|
|
|
|
while self.line.rstrip() in self.FEATURE_START_MARKERS:
|
|
self.line = self.handle.readline()
|
|
|
|
bad_position_re = re.compile(r'([0-9]+)>{1}')
|
|
|
|
features = []
|
|
line = self.line
|
|
while True:
|
|
if not line:
|
|
raise ValueError("Premature end of line during features table")
|
|
if line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS:
|
|
if self.debug:
|
|
print("Found start of sequence")
|
|
break
|
|
line = line.rstrip()
|
|
if line == "//":
|
|
raise ValueError("Premature end of features table, marker '//' found")
|
|
if line in self.FEATURE_END_MARKERS:
|
|
if self.debug:
|
|
print("Found end of features")
|
|
line = self.handle.readline()
|
|
break
|
|
if line[2:self.FEATURE_QUALIFIER_INDENT].strip() == "":
|
|
# This is an empty feature line between qualifiers. Empty
|
|
# feature lines within qualifiers are handled below (ignored).
|
|
line = self.handle.readline()
|
|
continue
|
|
|
|
if skip:
|
|
line = self.handle.readline()
|
|
while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER:
|
|
line = self.handle.readline()
|
|
else:
|
|
assert line[:2] == "FT"
|
|
try:
|
|
feature_key, location_start = line[2:].strip().split()
|
|
except ValueError:
|
|
# e.g. "FT TRANSMEMBRANE-REGION2163..2240\n"
|
|
# Assume indent of 25 as per IMGT spec, with the location
|
|
# start in column 26 (one-based).
|
|
feature_key = line[2:25].strip()
|
|
location_start = line[25:].strip()
|
|
feature_lines = [location_start]
|
|
line = self.handle.readline()
|
|
while line[:self.FEATURE_QUALIFIER_INDENT] == self.FEATURE_QUALIFIER_SPACER \
|
|
or line.rstrip() == "": # cope with blank lines in the midst of a feature
|
|
# Use strip to remove any harmless trailing white space AND and leading
|
|
# white space (copes with 21 or 26 indents and orther variants)
|
|
assert line[:2] == "FT"
|
|
feature_lines.append(line[self.FEATURE_QUALIFIER_INDENT:].strip())
|
|
line = self.handle.readline()
|
|
feature_key, location, qualifiers = \
|
|
self.parse_feature(feature_key, feature_lines)
|
|
# Try to handle known problems with IMGT locations here:
|
|
if ">" in location:
|
|
# Nasty hack for common IMGT bug, should be >123 not 123>
|
|
# in a location string. At least here the meaning is clear,
|
|
# and since it is so common I don't want to issue a warning
|
|
# warnings.warn("Feature location %s is invalid, "
|
|
# "moving greater than sign before position"
|
|
# % location, BiopythonParserWarning)
|
|
location = bad_position_re.sub(r'>\1', location)
|
|
features.append((feature_key, location, qualifiers))
|
|
self.line = line
|
|
return features
|
|
|
|
|
|
class GenBankScanner(InsdcScanner):
|
|
"""For extracting chunks of information in GenBank files"""
|
|
|
|
RECORD_START = "LOCUS "
|
|
HEADER_WIDTH = 12
|
|
FEATURE_START_MARKERS = ["FEATURES Location/Qualifiers", "FEATURES"]
|
|
FEATURE_END_MARKERS = []
|
|
FEATURE_QUALIFIER_INDENT = 21
|
|
FEATURE_QUALIFIER_SPACER = " " * FEATURE_QUALIFIER_INDENT
|
|
SEQUENCE_HEADERS = ["CONTIG", "ORIGIN", "BASE COUNT", "WGS"] # trailing spaces removed
|
|
|
|
def parse_footer(self):
|
|
"""returns a tuple containing a list of any misc strings, and the sequence"""
|
|
assert self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS, \
|
|
"Eh? '%s'" % self.line
|
|
|
|
misc_lines = []
|
|
while self.line[:self.HEADER_WIDTH].rstrip() in self.SEQUENCE_HEADERS \
|
|
or self.line[:self.HEADER_WIDTH] == " " * self.HEADER_WIDTH \
|
|
or "WGS" == self.line[:3]:
|
|
misc_lines.append(self.line.rstrip())
|
|
self.line = self.handle.readline()
|
|
if not self.line:
|
|
raise ValueError("Premature end of file")
|
|
self.line = self.line
|
|
|
|
assert self.line[:self.HEADER_WIDTH].rstrip() not in self.SEQUENCE_HEADERS, \
|
|
"Eh? '%s'" % self.line
|
|
|
|
# Now just consume the sequence lines until reach the // marker
|
|
# or a CONTIG line
|
|
seq_lines = []
|
|
line = self.line
|
|
while True:
|
|
if not line:
|
|
warnings.warn("Premature end of file in sequence data",
|
|
BiopythonParserWarning)
|
|
line = '//'
|
|
break
|
|
line = line.rstrip()
|
|
if not line:
|
|
warnings.warn("Blank line in sequence data",
|
|
BiopythonParserWarning)
|
|
line = self.handle.readline()
|
|
continue
|
|
if line == '//':
|
|
break
|
|
if line.startswith('CONTIG'):
|
|
break
|
|
if len(line) > 9 and line[9:10] != ' ':
|
|
# Some broken programs indent the sequence by one space too many
|
|
# so try to get rid of that and test again.
|
|
warnings.warn("Invalid indentation for sequence line",
|
|
BiopythonParserWarning)
|
|
line = line[1:]
|
|
if len(line) > 9 and line[9:10] != ' ':
|
|
raise ValueError("Sequence line mal-formed, '%s'" % line)
|
|
seq_lines.append(line[10:]) # remove spaces later
|
|
line = self.handle.readline()
|
|
|
|
self.line = line
|
|
# Seq("".join(seq_lines), self.alphabet)
|
|
return (misc_lines, "".join(seq_lines).replace(" ", ""))
|
|
|
|
def _feed_first_line(self, consumer, line):
|
|
"""Scan over and parse GenBank LOCUS line (PRIVATE).
|
|
|
|
This must cope with several variants, primarily the old and new column
|
|
based standards from GenBank. Additionally EnsEMBL produces GenBank
|
|
files where the LOCUS line is space separated rather that following
|
|
the column based layout.
|
|
|
|
We also try to cope with GenBank like files with partial LOCUS lines.
|
|
"""
|
|
#####################################
|
|
# LOCUS line #
|
|
#####################################
|
|
GENBANK_INDENT = self.HEADER_WIDTH
|
|
GENBANK_SPACER = " " * GENBANK_INDENT
|
|
assert line[0:GENBANK_INDENT] == 'LOCUS ', \
|
|
'LOCUS line does not start correctly:\n' + line
|
|
|
|
# Have to break up the locus line, and handle the different bits of it.
|
|
# There are at least two different versions of the locus line...
|
|
if line[29:33] in [' bp ', ' aa ', ' rc '] and line[55:62] == ' ':
|
|
# Old... note we insist on the 55:62 being empty to avoid trying
|
|
# to parse space separated LOCUS lines from Ensembl etc, see below.
|
|
#
|
|
# Positions Contents
|
|
# --------- --------
|
|
# 00:06 LOCUS
|
|
# 06:12 spaces
|
|
# 12:?? Locus name
|
|
# ??:?? space
|
|
# ??:29 Length of sequence, right-justified
|
|
# 29:33 space, bp, space
|
|
# 33:41 strand type
|
|
# 41:42 space
|
|
# 42:51 Blank (implies linear), linear or circular
|
|
# 51:52 space
|
|
# 52:55 The division code (e.g. BCT, VRL, INV)
|
|
# 55:62 space
|
|
# 62:73 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
|
|
#
|
|
# assert line[29:33] in [' bp ', ' aa ',' rc '] , \
|
|
# 'LOCUS line does not contain size units at expected position:\n' + line
|
|
assert line[41:42] == ' ', \
|
|
'LOCUS line does not contain space at position 42:\n' + line
|
|
assert line[42:51].strip() in ['', 'linear', 'circular'], \
|
|
'LOCUS line does not contain valid entry (linear, circular, ...):\n' + line
|
|
assert line[51:52] == ' ', \
|
|
'LOCUS line does not contain space at position 52:\n' + line
|
|
# assert line[55:62] == ' ', \
|
|
# 'LOCUS line does not contain spaces from position 56 to 62:\n' + line
|
|
if line[62:73].strip():
|
|
assert line[64:65] == '-', \
|
|
'LOCUS line does not contain - at position 65 in date:\n' + line
|
|
assert line[68:69] == '-', \
|
|
'LOCUS line does not contain - at position 69 in date:\n' + line
|
|
|
|
name_and_length_str = line[GENBANK_INDENT:29]
|
|
while ' ' in name_and_length_str:
|
|
name_and_length_str = name_and_length_str.replace(' ', ' ')
|
|
name_and_length = name_and_length_str.split(' ')
|
|
assert len(name_and_length) <= 2, \
|
|
'Cannot parse the name and length in the LOCUS line:\n' + line
|
|
assert len(name_and_length) != 1, \
|
|
'Name and length collide in the LOCUS line:\n' + line
|
|
# Should be possible to split them based on position, if
|
|
# a clear definition of the standard exists THAT AGREES with
|
|
# existing files.
|
|
name, length = name_and_length
|
|
if len(name) > 16:
|
|
# As long as the sequence is short, can steal its leading spaces
|
|
# to extend the name over the current 16 character limit.
|
|
# However, that deserves a warning as it is out of spec.
|
|
warnings.warn("GenBank LOCUS line identifier over 16 characters",
|
|
BiopythonParserWarning)
|
|
consumer.locus(name)
|
|
consumer.size(length)
|
|
# consumer.residue_type(line[33:41].strip())
|
|
|
|
if line[33:51].strip() == "" and line[29:33] == ' aa ':
|
|
# Amino acids -> protein (even if there is no residue type given)
|
|
# We want to use a protein alphabet in this case, rather than a
|
|
# generic one. Not sure if this is the best way to achieve this,
|
|
# but it works because the scanner checks for this:
|
|
consumer.residue_type("PROTEIN")
|
|
else:
|
|
consumer.residue_type(line[33:51].strip())
|
|
|
|
consumer.topology(line[42:51].strip())
|
|
consumer.data_file_division(line[52:55])
|
|
if line[62:73].strip():
|
|
consumer.date(line[62:73])
|
|
elif line[40:44] in [' bp ', ' aa ', ' rc '] \
|
|
and line[54:64].strip() in ['', 'linear', 'circular']:
|
|
# New... linear/circular/big blank test should avoid EnsEMBL style
|
|
# LOCUS line being treated like a proper column based LOCUS line.
|
|
#
|
|
# Positions Contents
|
|
# --------- --------
|
|
# 00:06 LOCUS
|
|
# 06:12 spaces
|
|
# 12:?? Locus name
|
|
# ??:?? space
|
|
# ??:40 Length of sequence, right-justified
|
|
# 40:44 space, bp, space
|
|
# 44:47 Blank, ss-, ds-, ms-
|
|
# 47:54 Blank, DNA, RNA, tRNA, mRNA, uRNA, snRNA, cDNA
|
|
# 54:55 space
|
|
# 55:63 Blank (implies linear), linear or circular
|
|
# 63:64 space
|
|
# 64:67 The division code (e.g. BCT, VRL, INV)
|
|
# 67:68 space
|
|
# 68:79 Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
|
|
#
|
|
assert line[40:44] in [' bp ', ' aa ', ' rc '], \
|
|
'LOCUS line does not contain size units at expected position:\n' + line
|
|
assert line[44:47] in [' ', 'ss-', 'ds-', 'ms-'], \
|
|
'LOCUS line does not have valid strand type (Single stranded, ...):\n' + line
|
|
assert line[47:54].strip() == "" \
|
|
or 'DNA' in line[47:54].strip().upper() \
|
|
or 'RNA' in line[47:54].strip().upper(), \
|
|
'LOCUS line does not contain valid sequence type (DNA, RNA, ...):\n' + line
|
|
assert line[54:55] == ' ', \
|
|
'LOCUS line does not contain space at position 55:\n' + line
|
|
assert line[55:63].strip() in ['', 'linear', 'circular'], \
|
|
'LOCUS line does not contain valid entry (linear, circular, ...):\n' + line
|
|
assert line[63:64] == ' ', \
|
|
'LOCUS line does not contain space at position 64:\n' + line
|
|
assert line[67:68] == ' ', \
|
|
'LOCUS line does not contain space at position 68:\n' + line
|
|
if line[68:79].strip():
|
|
assert line[70:71] == '-', \
|
|
'LOCUS line does not contain - at position 71 in date:\n' + line
|
|
assert line[74:75] == '-', \
|
|
'LOCUS line does not contain - at position 75 in date:\n' + line
|
|
|
|
name_and_length_str = line[GENBANK_INDENT:40]
|
|
while ' ' in name_and_length_str:
|
|
name_and_length_str = name_and_length_str.replace(' ', ' ')
|
|
name_and_length = name_and_length_str.split(' ')
|
|
assert len(name_and_length) <= 2, \
|
|
'Cannot parse the name and length in the LOCUS line:\n' + line
|
|
assert len(name_and_length) != 1, \
|
|
'Name and length collide in the LOCUS line:\n' + line
|
|
# Should be possible to split them based on position, if
|
|
# a clear definition of the stand exists THAT AGREES with
|
|
# existing files.
|
|
consumer.locus(name_and_length[0])
|
|
consumer.size(name_and_length[1])
|
|
|
|
if line[44:54].strip() == "" and line[40:44] == ' aa ':
|
|
# Amino acids -> protein (even if there is no residue type given)
|
|
# We want to use a protein alphabet in this case, rather than a
|
|
# generic one. Not sure if this is the best way to achieve this,
|
|
# but it works because the scanner checks for this:
|
|
consumer.residue_type(("PROTEIN " + line[54:63]).strip())
|
|
else:
|
|
consumer.residue_type(line[44:63].strip())
|
|
|
|
consumer.topology(line[55:63].strip())
|
|
consumer.data_file_division(line[64:67])
|
|
if line[68:79].strip():
|
|
consumer.date(line[68:79])
|
|
elif line[GENBANK_INDENT:].strip().count(" ") == 0:
|
|
# Truncated LOCUS line, as produced by some EMBOSS tools - see bug 1762
|
|
#
|
|
# e.g.
|
|
#
|
|
# "LOCUS U00096"
|
|
#
|
|
# rather than:
|
|
#
|
|
# "LOCUS U00096 4639675 bp DNA circular BCT"
|
|
#
|
|
# Positions Contents
|
|
# --------- --------
|
|
# 00:06 LOCUS
|
|
# 06:12 spaces
|
|
# 12:?? Locus name
|
|
if line[GENBANK_INDENT:].strip() != "":
|
|
consumer.locus(line[GENBANK_INDENT:].strip())
|
|
else:
|
|
# Must just have just "LOCUS ", is this even legitimate?
|
|
# We should be able to continue parsing... we need real world testcases!
|
|
warnings.warn("Minimal LOCUS line found - is this "
|
|
"correct?\n:%r" % line, BiopythonParserWarning)
|
|
elif len(line.split()) == 8 and line.split()[3] in ("aa", "bp") and \
|
|
line.split()[5] in ('linear', 'circular'):
|
|
# Cope with invalidly spaced GenBank LOCUS lines like
|
|
# LOCUS AB070938 6497 bp DNA linear BCT 11-OCT-2001
|
|
splitline = line.split()
|
|
consumer.locus(splitline[1])
|
|
consumer.size(splitline[2])
|
|
consumer.residue_type(splitline[4])
|
|
consumer.topology(splitline[5])
|
|
consumer.data_file_division(splitline[6])
|
|
consumer.date(splitline[7])
|
|
warnings.warn("Attempting to parse malformed locus line:\n%r\n"
|
|
"Found locus %r size %r residue_type %r\n"
|
|
"Some fields may be wrong." % (line, splitline[1],
|
|
splitline[2], splitline[4]), BiopythonParserWarning)
|
|
elif len(line.split()) == 7 and line.split()[3] in ["aa", "bp"]:
|
|
# Cope with EnsEMBL genbank files which use space separation rather
|
|
# than the expected column based layout. e.g.
|
|
# LOCUS HG531_PATCH 1000000 bp DNA HTG 18-JUN-2011
|
|
# LOCUS HG531_PATCH 759984 bp DNA HTG 18-JUN-2011
|
|
# LOCUS HG506_HG1000_1_PATCH 814959 bp DNA HTG 18-JUN-2011
|
|
# LOCUS HG506_HG1000_1_PATCH 1219964 bp DNA HTG 18-JUN-2011
|
|
# Notice that the 'bp' can occur in the position expected by either
|
|
# the old or the new fixed column standards (parsed above).
|
|
splitline = line.split()
|
|
consumer.locus(splitline[1])
|
|
consumer.size(splitline[2])
|
|
consumer.residue_type(splitline[4])
|
|
consumer.data_file_division(splitline[5])
|
|
consumer.date(splitline[6])
|
|
elif len(line.split()) >= 4 and line.split()[3] in ["aa", "bp"]:
|
|
# Cope with EMBOSS seqret output where it seems the locus id can cause
|
|
# the other fields to overflow. We just IGNORE the other fields!
|
|
warnings.warn("Malformed LOCUS line found - is this "
|
|
"correct?\n:%r" % line, BiopythonParserWarning)
|
|
consumer.locus(line.split()[1])
|
|
consumer.size(line.split()[2])
|
|
elif len(line.split()) >= 4 and line.split()[-1] in ["aa", "bp"]:
|
|
# Cope with pseudo-GenBank files like this:
|
|
# "LOCUS RNA5 complete 1718 bp"
|
|
# Treat everything between LOCUS and the size as the identifier.
|
|
warnings.warn("Malformed LOCUS line found - is this "
|
|
"correct?\n:%r" % line, BiopythonParserWarning)
|
|
consumer.locus(line[5:].rsplit(None, 2)[0].strip())
|
|
consumer.size(line.split()[-2])
|
|
else:
|
|
raise ValueError('Did not recognise the LOCUS line layout:\n' + line)
|
|
|
|
def _feed_header_lines(self, consumer, lines):
|
|
# Following dictionary maps GenBank lines to the associated
|
|
# consumer methods - the special cases like LOCUS where one
|
|
# genbank line triggers several consumer calls have to be
|
|
# handled individually.
|
|
GENBANK_INDENT = self.HEADER_WIDTH
|
|
GENBANK_SPACER = " " * GENBANK_INDENT
|
|
STRUCTURED_COMMENT_START = "-START##"
|
|
STRUCTURED_COMMENT_END = "-END##"
|
|
STRUCTURED_COMMENT_DELIM = " :: "
|
|
consumer_dict = {
|
|
'DEFINITION': 'definition',
|
|
'ACCESSION': 'accession',
|
|
'NID': 'nid',
|
|
'PID': 'pid',
|
|
'DBSOURCE': 'db_source',
|
|
'KEYWORDS': 'keywords',
|
|
'SEGMENT': 'segment',
|
|
'SOURCE': 'source',
|
|
'AUTHORS': 'authors',
|
|
'CONSRTM': 'consrtm',
|
|
'PROJECT': 'project',
|
|
'TITLE': 'title',
|
|
'JOURNAL': 'journal',
|
|
'MEDLINE': 'medline_id',
|
|
'PUBMED': 'pubmed_id',
|
|
'REMARK': 'remark'}
|
|
# We have to handle the following specially:
|
|
# ORIGIN (locus, size, residue_type, data_file_division and date)
|
|
# COMMENT (comment)
|
|
# VERSION (version and gi)
|
|
# DBLINK (database links like projects, newlines important)
|
|
# REFERENCE (eference_num and reference_bases)
|
|
# ORGANISM (organism and taxonomy)
|
|
lines = [_f for _f in lines if _f]
|
|
lines.append("") # helps avoid getting StopIteration all the time
|
|
line_iter = iter(lines)
|
|
try:
|
|
line = next(line_iter)
|
|
while True:
|
|
if not line:
|
|
break
|
|
line_type = line[:GENBANK_INDENT].strip()
|
|
data = line[GENBANK_INDENT:].strip()
|
|
|
|
if line_type == 'VERSION':
|
|
# Need to call consumer.version(), and maybe also consumer.gi() as well.
|
|
# e.g.
|
|
# VERSION AC007323.5 GI:6587720
|
|
while ' ' in data:
|
|
data = data.replace(' ', ' ')
|
|
if ' GI:' not in data:
|
|
consumer.version(data)
|
|
else:
|
|
if self.debug:
|
|
print("Version [" + data.split(' GI:')[0] + "], gi [" + data.split(' GI:')[1] + "]")
|
|
consumer.version(data.split(' GI:')[0])
|
|
consumer.gi(data.split(' GI:')[1])
|
|
# Read in the next line!
|
|
line = next(line_iter)
|
|
elif line_type == 'DBLINK':
|
|
# Need to call consumer.dblink() for each line, e.g.
|
|
# DBLINK Project: 57779
|
|
# BioProject: PRJNA57779
|
|
consumer.dblink(data.strip())
|
|
# Read in the next line, and see if its more of the DBLINK section:
|
|
while True:
|
|
line = next(line_iter)
|
|
if line[:GENBANK_INDENT] == GENBANK_SPACER:
|
|
# Add this continuation to the data string
|
|
consumer.dblink(line[GENBANK_INDENT:].strip())
|
|
else:
|
|
# End of the DBLINK, leave this text in the variable "line"
|
|
break
|
|
elif line_type == 'REFERENCE':
|
|
if self.debug > 1:
|
|
print("Found reference [" + data + "]")
|
|
# Need to call consumer.reference_num() and consumer.reference_bases()
|
|
# e.g.
|
|
# REFERENCE 1 (bases 1 to 86436)
|
|
#
|
|
# Note that this can be multiline, see Bug 1968, e.g.
|
|
#
|
|
# REFERENCE 42 (bases 1517 to 1696; 3932 to 4112; 17880 to 17975; 21142 to
|
|
# 28259)
|
|
#
|
|
# For such cases we will call the consumer once only.
|
|
data = data.strip()
|
|
|
|
# Read in the next line, and see if its more of the reference:
|
|
while True:
|
|
line = next(line_iter)
|
|
if line[:GENBANK_INDENT] == GENBANK_SPACER:
|
|
# Add this continuation to the data string
|
|
data += " " + line[GENBANK_INDENT:]
|
|
if self.debug > 1:
|
|
print("Extended reference text [" + data + "]")
|
|
else:
|
|
# End of the reference, leave this text in the variable "line"
|
|
break
|
|
|
|
# We now have all the reference line(s) stored in a string, data,
|
|
# which we pass to the consumer
|
|
while ' ' in data:
|
|
data = data.replace(' ', ' ')
|
|
if ' ' not in data:
|
|
if self.debug > 2:
|
|
print('Reference number \"' + data + '\"')
|
|
consumer.reference_num(data)
|
|
else:
|
|
if self.debug > 2:
|
|
print('Reference number \"' + data[:data.find(' ')] + '\", \"' + data[data.find(' ') + 1:] + '\"')
|
|
consumer.reference_num(data[:data.find(' ')])
|
|
consumer.reference_bases(data[data.find(' ') + 1:])
|
|
elif line_type == 'ORGANISM':
|
|
# Typically the first line is the organism, and subsequent lines
|
|
# are the taxonomy lineage. However, given longer and longer
|
|
# species names (as more and more strains and sub strains get
|
|
# sequenced) the oragnism name can now get wrapped onto multiple
|
|
# lines. The NCBI say we have to recognise the lineage line by
|
|
# the presence of semi-colon delimited entries. In the long term,
|
|
# they are considering adding a new keyword (e.g. LINEAGE).
|
|
# See Bug 2591 for details.
|
|
organism_data = data
|
|
lineage_data = ""
|
|
while True:
|
|
line = next(line_iter)
|
|
if line[0:GENBANK_INDENT] == GENBANK_SPACER:
|
|
if lineage_data or ";" in line:
|
|
lineage_data += " " + line[GENBANK_INDENT:]
|
|
elif line[GENBANK_INDENT:].strip() == ".":
|
|
# No lineage data, just . place holder
|
|
pass
|
|
else:
|
|
organism_data += " " + line[GENBANK_INDENT:].strip()
|
|
else:
|
|
# End of organism and taxonomy
|
|
break
|
|
consumer.organism(organism_data)
|
|
if lineage_data.strip() == "" and self.debug > 1:
|
|
print("Taxonomy line(s) missing or blank")
|
|
consumer.taxonomy(lineage_data.strip())
|
|
del organism_data, lineage_data
|
|
elif line_type == 'COMMENT':
|
|
# A COMMENT can either be plain text or tabular (Structured Comment),
|
|
# or contain both. Multiline comments are common. The code calls
|
|
# consumer.comment() once with a list where each entry
|
|
# is a line. If there's a structured comment consumer.structured_comment()
|
|
# is called with a dict of dicts where the secondary key/value pairs are
|
|
# the same as those in the structured comment table. The primary key is
|
|
# the title or header of the table (e.g. Assembly-Data, FluData). See
|
|
# http://www.ncbi.nlm.nih.gov/genbank/structuredcomment
|
|
# for more information on Structured Comments.
|
|
data = line[GENBANK_INDENT:]
|
|
if self.debug > 1:
|
|
print("Found comment")
|
|
comment_list = []
|
|
structured_comment_dict = defaultdict(dict)
|
|
structured_comment_key = ''
|
|
|
|
if STRUCTURED_COMMENT_START in data:
|
|
structured_comment_key = re.search(r"([^#]+){0}$".format(STRUCTURED_COMMENT_START), data).group(1)
|
|
if self.debug > 1:
|
|
print("Found Structured Comment")
|
|
else:
|
|
comment_list.append(data)
|
|
|
|
while True:
|
|
line = next(line_iter)
|
|
data = line[GENBANK_INDENT:]
|
|
if line[0:GENBANK_INDENT] == GENBANK_SPACER:
|
|
if STRUCTURED_COMMENT_START in data:
|
|
structured_comment_key = re.search(r"([^#]+){0}$".format(STRUCTURED_COMMENT_START), data).group(1)
|
|
elif structured_comment_key is not None and STRUCTURED_COMMENT_DELIM in data:
|
|
match = re.search(r"(.+?)\s*{0}\s*(.+)".format(STRUCTURED_COMMENT_DELIM), data)
|
|
structured_comment_dict[structured_comment_key][match.group(1)] = match.group(2)
|
|
if self.debug > 2:
|
|
print("Structured Comment continuation [" + data + "]")
|
|
elif STRUCTURED_COMMENT_END not in data:
|
|
comment_list.append(data)
|
|
if self.debug > 2:
|
|
print("Comment continuation [" + data + "]")
|
|
else:
|
|
# End of the comment
|
|
break
|
|
if comment_list:
|
|
consumer.comment(comment_list)
|
|
if structured_comment_dict:
|
|
consumer.structured_comment(structured_comment_dict)
|
|
del comment_list, structured_comment_key, structured_comment_dict
|
|
elif line_type in consumer_dict:
|
|
# It's a semi-automatic entry!
|
|
# Now, this may be a multi line entry...
|
|
while True:
|
|
line = next(line_iter)
|
|
if line[0:GENBANK_INDENT] == GENBANK_SPACER:
|
|
data += ' ' + line[GENBANK_INDENT:]
|
|
else:
|
|
# We now have all the data for this entry:
|
|
|
|
# The DEFINITION field must ends with a period
|
|
# # see ftp://ftp.ncbi.nih.gov/genbank/gbrel.txt [3.4.5]
|
|
# and discussion https://github.com/biopython/biopython/pull/616
|
|
# We consider this period belong to the syntax, not to the data
|
|
# So remove it if it exist
|
|
if line_type == 'DEFINITION' and data.endswith('.'):
|
|
data = data[:-1]
|
|
getattr(consumer, consumer_dict[line_type])(data)
|
|
# End of continuation - return to top of loop!
|
|
break
|
|
else:
|
|
if self.debug:
|
|
print("Ignoring GenBank header line:\n" % line)
|
|
# Read in next line
|
|
line = next(line_iter)
|
|
except StopIteration:
|
|
raise ValueError("Problem in header")
|
|
|
|
def _feed_misc_lines(self, consumer, lines):
|
|
# Deals with a few misc lines between the features and the sequence
|
|
GENBANK_INDENT = self.HEADER_WIDTH
|
|
GENBANK_SPACER = " " * GENBANK_INDENT
|
|
lines.append("")
|
|
line_iter = iter(lines)
|
|
try:
|
|
for line in line_iter:
|
|
if line.startswith('BASE COUNT'):
|
|
line = line[10:].strip()
|
|
if line:
|
|
if self.debug:
|
|
print("base_count = " + line)
|
|
consumer.base_count(line)
|
|
if line.startswith('ORIGIN'):
|
|
line = line[6:].strip()
|
|
if line:
|
|
if self.debug:
|
|
print("origin_name = " + line)
|
|
consumer.origin_name(line)
|
|
if line.startswith('WGS '):
|
|
line = line[3:].strip()
|
|
consumer.wgs(line)
|
|
if line.startswith('WGS_SCAFLD'):
|
|
line = line[10:].strip()
|
|
consumer.add_wgs_scafld(line)
|
|
if line.startswith('CONTIG'):
|
|
line = line[6:].strip()
|
|
contig_location = line
|
|
while True:
|
|
line = next(line_iter)
|
|
if not line:
|
|
break
|
|
elif line[:GENBANK_INDENT] == GENBANK_SPACER:
|
|
# Don't need to preseve the whitespace here.
|
|
contig_location += line[GENBANK_INDENT:].rstrip()
|
|
elif line.startswith('ORIGIN'):
|
|
# Strange, seen this in GenPept files via Entrez gbwithparts
|
|
line = line[6:].strip()
|
|
if line:
|
|
consumer.origin_name(line)
|
|
break
|
|
else:
|
|
raise ValueError('Expected CONTIG continuation line, got:\n' + line)
|
|
consumer.contig_location(contig_location)
|
|
return
|
|
except StopIteration:
|
|
raise ValueError("Problem in misc lines before sequence")
|
|
|
|
if __name__ == "__main__":
|
|
from Bio._py3k import StringIO
|
|
|
|
gbk_example = \
|
|
"""LOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999
|
|
DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p
|
|
(AXL2) and Rev7p (REV7) genes, complete cds.
|
|
ACCESSION U49845
|
|
VERSION U49845.1 GI:1293613
|
|
KEYWORDS .
|
|
SOURCE Saccharomyces cerevisiae (baker's yeast)
|
|
ORGANISM Saccharomyces cerevisiae
|
|
Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes;
|
|
Saccharomycetales; Saccharomycetaceae; Saccharomyces.
|
|
REFERENCE 1 (bases 1 to 5028)
|
|
AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W.
|
|
TITLE Cloning and sequence of REV7, a gene whose function is required for
|
|
DNA damage-induced mutagenesis in Saccharomyces cerevisiae
|
|
JOURNAL Yeast 10 (11), 1503-1509 (1994)
|
|
PUBMED 7871890
|
|
REFERENCE 2 (bases 1 to 5028)
|
|
AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M.
|
|
TITLE Selection of axial growth sites in yeast requires Axl2p, a novel
|
|
plasma membrane glycoprotein
|
|
JOURNAL Genes Dev. 10 (7), 777-793 (1996)
|
|
PUBMED 8846915
|
|
REFERENCE 3 (bases 1 to 5028)
|
|
AUTHORS Roemer,T.
|
|
TITLE Direct Submission
|
|
JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New
|
|
Haven, CT, USA
|
|
FEATURES Location/Qualifiers
|
|
source 1..5028
|
|
/organism="Saccharomyces cerevisiae"
|
|
/db_xref="taxon:4932"
|
|
/chromosome="IX"
|
|
/map="9"
|
|
CDS <1..206
|
|
/codon_start=3
|
|
/product="TCP1-beta"
|
|
/protein_id="AAA98665.1"
|
|
/db_xref="GI:1293614"
|
|
/translation="SSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEA
|
|
AEVLLRVDNIIRARPRTANRQHM"
|
|
gene 687..3158
|
|
/gene="AXL2"
|
|
CDS 687..3158
|
|
/gene="AXL2"
|
|
/note="plasma membrane glycoprotein"
|
|
/codon_start=1
|
|
/function="required for axial budding pattern of S.
|
|
cerevisiae"
|
|
/product="Axl2p"
|
|
/protein_id="AAA98666.1"
|
|
/db_xref="GI:1293615"
|
|
/translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESF
|
|
TFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFN
|
|
VILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNE
|
|
VFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPE
|
|
TSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYV
|
|
YLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYG
|
|
DVIYFNFEVVSTTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQ
|
|
DHDWVKFQSSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSA
|
|
NATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIA
|
|
CGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLN
|
|
NPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQ
|
|
SQSKEELLAKPPVQPPESPFFDPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDS
|
|
YGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTK
|
|
HRNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRL
|
|
VDFSNKSNVNVGQVKDIHGRIPEML"
|
|
gene complement(3300..4037)
|
|
/gene="REV7"
|
|
CDS complement(3300..4037)
|
|
/gene="REV7"
|
|
/codon_start=1
|
|
/product="Rev7p"
|
|
/protein_id="AAA98667.1"
|
|
/db_xref="GI:1293616"
|
|
/translation="MNRWVEKWLRVYLKCYINLILFYRNVYPPQSFDYTTYQSFNLPQ
|
|
FVPINRHPALIDYIEELILDVLSKLTHVYRFSICIINKKNDLCIEKYVLDFSELQHVD
|
|
KDDQIITETEVFDEFRSSLNSLIMHLEKLPKVNDDTITFEAVINAIELELGHKLDRNR
|
|
RVDSLEEKAEIERDSNWVKCQEDENLPDNNGFQPPKIKLTSLVGSDVGPLIIHQFSEK
|
|
LISGDDKILNGVYSQYEEGESIFGSLF"
|
|
ORIGIN
|
|
1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg
|
|
61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct
|
|
121 ctgcatctga agccgctgaa gttctactaa gggtggataa catcatccgt gcaagaccaa
|
|
181 gaaccgccaa tagacaacat atgtaacata tttaggatat acctcgaaaa taataaaccg
|
|
241 ccacactgtc attattataa ttagaaacag aacgcaaaaa ttatccacta tataattcaa
|
|
301 agacgcgaaa aaaaaagaac aacgcgtcat agaacttttg gcaattcgcg tcacaaataa
|
|
361 attttggcaa cttatgtttc ctcttcgagc agtactcgag ccctgtctca agaatgtaat
|
|
421 aatacccatc gtaggtatgg ttaaagatag catctccaca acctcaaagc tccttgccga
|
|
481 gagtcgccct cctttgtcga gtaattttca cttttcatat gagaacttat tttcttattc
|
|
541 tttactctca catcctgtag tgattgacac tgcaacagcc accatcacta gaagaacaga
|
|
601 acaattactt aatagaaaaa ttatatcttc ctcgaaacga tttcctgctt ccaacatcta
|
|
661 cgtatatcaa gaagcattca cttaccatga cacagcttca gatttcatta ttgctgacag
|
|
721 ctactatatc actactccat ctagtagtgg ccacgcccta tgaggcatat cctatcggaa
|
|
781 aacaataccc cccagtggca agagtcaatg aatcgtttac atttcaaatt tccaatgata
|
|
841 cctataaatc gtctgtagac aagacagctc aaataacata caattgcttc gacttaccga
|
|
901 gctggctttc gtttgactct agttctagaa cgttctcagg tgaaccttct tctgacttac
|
|
961 tatctgatgc gaacaccacg ttgtatttca atgtaatact cgagggtacg gactctgccg
|
|
1021 acagcacgtc tttgaacaat acataccaat ttgttgttac aaaccgtcca tccatctcgc
|
|
1081 tatcgtcaga tttcaatcta ttggcgttgt taaaaaacta tggttatact aacggcaaaa
|
|
1141 acgctctgaa actagatcct aatgaagtct tcaacgtgac ttttgaccgt tcaatgttca
|
|
1201 ctaacgaaga atccattgtg tcgtattacg gacgttctca gttgtataat gcgccgttac
|
|
1261 ccaattggct gttcttcgat tctggcgagt tgaagtttac tgggacggca ccggtgataa
|
|
1321 actcggcgat tgctccagaa acaagctaca gttttgtcat catcgctaca gacattgaag
|
|
1381 gattttctgc cgttgaggta gaattcgaat tagtcatcgg ggctcaccag ttaactacct
|
|
1441 ctattcaaaa tagtttgata atcaacgtta ctgacacagg taacgtttca tatgacttac
|
|
1501 ctctaaacta tgtttatctc gatgacgatc ctatttcttc tgataaattg ggttctataa
|
|
1561 acttattgga tgctccagac tgggtggcat tagataatgc taccatttcc gggtctgtcc
|
|
1621 cagatgaatt actcggtaag aactccaatc ctgccaattt ttctgtgtcc atttatgata
|
|
1681 cttatggtga tgtgatttat ttcaacttcg aagttgtctc cacaacggat ttgtttgcca
|
|
1741 ttagttctct tcccaatatt aacgctacaa ggggtgaatg gttctcctac tattttttgc
|
|
1801 cttctcagtt tacagactac gtgaatacaa acgtttcatt agagtttact aattcaagcc
|
|
1861 aagaccatga ctgggtgaaa ttccaatcat ctaatttaac attagctgga gaagtgccca
|
|
1921 agaatttcga caagctttca ttaggtttga aagcgaacca aggttcacaa tctcaagagc
|
|
1981 tatattttaa catcattggc atggattcaa agataactca ctcaaaccac agtgcgaatg
|
|
2041 caacgtccac aagaagttct caccactcca cctcaacaag ttcttacaca tcttctactt
|
|
2101 acactgcaaa aatttcttct acctccgctg ctgctacttc ttctgctcca gcagcgctgc
|
|
2161 cagcagccaa taaaacttca tctcacaata aaaaagcagt agcaattgcg tgcggtgttg
|
|
2221 ctatcccatt aggcgttatc ctagtagctc tcatttgctt cctaatattc tggagacgca
|
|
2281 gaagggaaaa tccagacgat gaaaacttac cgcatgctat tagtggacct gatttgaata
|
|
2341 atcctgcaaa taaaccaaat caagaaaacg ctacaccttt gaacaacccc tttgatgatg
|
|
2401 atgcttcctc gtacgatgat acttcaatag caagaagatt ggctgctttg aacactttga
|
|
2461 aattggataa ccactctgcc actgaatctg atatttccag cgtggatgaa aagagagatt
|
|
2521 ctctatcagg tatgaataca tacaatgatc agttccaatc ccaaagtaaa gaagaattat
|
|
2581 tagcaaaacc cccagtacag cctccagaga gcccgttctt tgacccacag aataggtctt
|
|
2641 cttctgtgta tatggatagt gaaccagcag taaataaatc ctggcgatat actggcaacc
|
|
2701 tgtcaccagt ctctgatatt gtcagagaca gttacggatc acaaaaaact gttgatacag
|
|
2761 aaaaactttt cgatttagaa gcaccagaga aggaaaaacg tacgtcaagg gatgtcacta
|
|
2821 tgtcttcact ggacccttgg aacagcaata ttagcccttc tcccgtaaga aaatcagtaa
|
|
2881 caccatcacc atataacgta acgaagcatc gtaaccgcca cttacaaaat attcaagact
|
|
2941 ctcaaagcgg taaaaacgga atcactccca caacaatgtc aacttcatct tctgacgatt
|
|
3001 ttgttccggt taaagatggt gaaaattttt gctgggtcca tagcatggaa ccagacagaa
|
|
3061 gaccaagtaa gaaaaggtta gtagattttt caaataagag taatgtcaat gttggtcaag
|
|
3121 ttaaggacat tcacggacgc atcccagaaa tgctgtgatt atacgcaacg atattttgct
|
|
3181 taattttatt ttcctgtttt attttttatt agtggtttac agatacccta tattttattt
|
|
3241 agtttttata cttagagaca tttaatttta attccattct tcaaatttca tttttgcact
|
|
3301 taaaacaaag atccaaaaat gctctcgccc tcttcatatt gagaatacac tccattcaaa
|
|
3361 attttgtcgt caccgctgat taatttttca ctaaactgat gaataatcaa aggccccacg
|
|
3421 tcagaaccga ctaaagaagt gagttttatt ttaggaggtt gaaaaccatt attgtctggt
|
|
3481 aaattttcat cttcttgaca tttaacccag tttgaatccc tttcaatttc tgctttttcc
|
|
3541 tccaaactat cgaccctcct gtttctgtcc aacttatgtc ctagttccaa ttcgatcgca
|
|
3601 ttaataactg cttcaaatgt tattgtgtca tcgttgactt taggtaattt ctccaaatgc
|
|
3661 ataatcaaac tatttaagga agatcggaat tcgtcgaaca cttcagtttc cgtaatgatc
|
|
3721 tgatcgtctt tatccacatg ttgtaattca ctaaaatcta aaacgtattt ttcaatgcat
|
|
3781 aaatcgttct ttttattaat aatgcagatg gaaaatctgt aaacgtgcgt taatttagaa
|
|
3841 agaacatcca gtataagttc ttctatatag tcaattaaag caggatgcct attaatggga
|
|
3901 acgaactgcg gcaagttgaa tgactggtaa gtagtgtagt cgaatgactg aggtgggtat
|
|
3961 acatttctat aaaataaaat caaattaatg tagcatttta agtataccct cagccacttc
|
|
4021 tctacccatc tattcataaa gctgacgcaa cgattactat tttttttttc ttcttggatc
|
|
4081 tcagtcgtcg caaaaacgta taccttcttt ttccgacctt ttttttagct ttctggaaaa
|
|
4141 gtttatatta gttaaacagg gtctagtctt agtgtgaaag ctagtggttt cgattgactg
|
|
4201 atattaagaa agtggaaatt aaattagtag tgtagacgta tatgcatatg tatttctcgc
|
|
4261 ctgtttatgt ttctacgtac ttttgattta tagcaagggg aaaagaaata catactattt
|
|
4321 tttggtaaag gtgaaagcat aatgtaaaag ctagaataaa atggacgaaa taaagagagg
|
|
4381 cttagttcat cttttttcca aaaagcaccc aatgataata actaaaatga aaaggatttg
|
|
4441 ccatctgtca gcaacatcag ttgtgtgagc aataataaaa tcatcacctc cgttgccttt
|
|
4501 agcgcgtttg tcgtttgtat cttccgtaat tttagtctta tcaatgggaa tcataaattt
|
|
4561 tccaatgaat tagcaatttc gtccaattct ttttgagctt cttcatattt gctttggaat
|
|
4621 tcttcgcact tcttttccca ttcatctctt tcttcttcca aagcaacgat ccttctaccc
|
|
4681 atttgctcag agttcaaatc ggcctctttc agtttatcca ttgcttcctt cagtttggct
|
|
4741 tcactgtctt ctagctgttg ttctagatcc tggtttttct tggtgtagtt ctcattatta
|
|
4801 gatctcaagt tattggagtc ttcagccaat tgctttgtat cagacaattg actctctaac
|
|
4861 ttctccactt cactgtcgag ttgctcgttt ttagcggaca aagatttaat ctcgttttct
|
|
4921 ttttcagtgt tagattgctc taattctttg agctgttctc tcagctcctc atatttttct
|
|
4981 tgccatgact cagattctaa ttttaagcta ttcaatttct ctttgatc
|
|
//"""
|
|
|
|
# GenBank format protein (aka GenPept) file from:
|
|
# http://www.molecularevolution.org/resources/fileformats/
|
|
gbk_example2 = \
|
|
"""LOCUS AAD51968 143 aa linear BCT 21-AUG-2001
|
|
DEFINITION transcriptional regulator RovA [Yersinia enterocolitica].
|
|
ACCESSION AAD51968
|
|
VERSION AAD51968.1 GI:5805369
|
|
DBSOURCE locus AF171097 accession AF171097.1
|
|
KEYWORDS .
|
|
SOURCE Yersinia enterocolitica
|
|
ORGANISM Yersinia enterocolitica
|
|
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
|
|
Enterobacteriaceae; Yersinia.
|
|
REFERENCE 1 (residues 1 to 143)
|
|
AUTHORS Revell,P.A. and Miller,V.L.
|
|
TITLE A chromosomally encoded regulator is required for expression of the
|
|
Yersinia enterocolitica inv gene and for virulence
|
|
JOURNAL Mol. Microbiol. 35 (3), 677-685 (2000)
|
|
MEDLINE 20138369
|
|
PUBMED 10672189
|
|
REFERENCE 2 (residues 1 to 143)
|
|
AUTHORS Revell,P.A. and Miller,V.L.
|
|
TITLE Direct Submission
|
|
JOURNAL Submitted (22-JUL-1999) Molecular Microbiology, Washington
|
|
University School of Medicine, Campus Box 8230, 660 South Euclid,
|
|
St. Louis, MO 63110, USA
|
|
COMMENT Method: conceptual translation.
|
|
FEATURES Location/Qualifiers
|
|
source 1..143
|
|
/organism="Yersinia enterocolitica"
|
|
/mol_type="unassigned DNA"
|
|
/strain="JB580v"
|
|
/serotype="O:8"
|
|
/db_xref="taxon:630"
|
|
Protein 1..143
|
|
/product="transcriptional regulator RovA"
|
|
/name="regulates inv expression"
|
|
CDS 1..143
|
|
/gene="rovA"
|
|
/coded_by="AF171097.1:380..811"
|
|
/note="regulator of virulence"
|
|
/transl_table=11
|
|
ORIGIN
|
|
1 mestlgsdla rlvrvwrali dhrlkplelt qthwvtlhni nrlppeqsqi qlakaigieq
|
|
61 pslvrtldql eekglitrht candrrakri klteqsspii eqvdgvicst rkeilggisp
|
|
121 deiellsgli dklerniiql qsk
|
|
//
|
|
"""
|
|
|
|
embl_example = """ID X56734; SV 1; linear; mRNA; STD; PLN; 1859 BP.
|
|
XX
|
|
AC X56734; S46826;
|
|
XX
|
|
DT 12-SEP-1991 (Rel. 29, Created)
|
|
DT 25-NOV-2005 (Rel. 85, Last updated, Version 11)
|
|
XX
|
|
DE Trifolium repens mRNA for non-cyanogenic beta-glucosidase
|
|
XX
|
|
KW beta-glucosidase.
|
|
XX
|
|
OS Trifolium repens (white clover)
|
|
OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
|
|
OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids;
|
|
OC eurosids I; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium.
|
|
XX
|
|
RN [5]
|
|
RP 1-1859
|
|
RX PUBMED; 1907511.
|
|
RA Oxtoby E., Dunn M.A., Pancoro A., Hughes M.A.;
|
|
RT "Nucleotide and derived amino acid sequence of the cyanogenic
|
|
RT beta-glucosidase (linamarase) from white clover (Trifolium repens L.)";
|
|
RL Plant Mol. Biol. 17(2):209-219(1991).
|
|
XX
|
|
RN [6]
|
|
RP 1-1859
|
|
RA Hughes M.A.;
|
|
RT ;
|
|
RL Submitted (19-NOV-1990) to the EMBL/GenBank/DDBJ databases.
|
|
RL Hughes M.A., University of Newcastle Upon Tyne, Medical School, Newcastle
|
|
RL Upon Tyne, NE2 4HH, UK
|
|
XX
|
|
FH Key Location/Qualifiers
|
|
FH
|
|
FT source 1..1859
|
|
FT /organism="Trifolium repens"
|
|
FT /mol_type="mRNA"
|
|
FT /clone_lib="lambda gt10"
|
|
FT /clone="TRE361"
|
|
FT /tissue_type="leaves"
|
|
FT /db_xref="taxon:3899"
|
|
FT CDS 14..1495
|
|
FT /product="beta-glucosidase"
|
|
FT /EC_number="3.2.1.21"
|
|
FT /note="non-cyanogenic"
|
|
FT /db_xref="GOA:P26204"
|
|
FT /db_xref="InterPro:IPR001360"
|
|
FT /db_xref="InterPro:IPR013781"
|
|
FT /db_xref="UniProtKB/Swiss-Prot:P26204"
|
|
FT /protein_id="CAA40058.1"
|
|
FT /translation="MDFIVAIFALFVISSFTITSTNAVEASTLLDIGNLSRSSFPRGFI
|
|
FT FGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEKIRDGSNADITVDQYHRYKEDVGIMK
|
|
FT DQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYNNLINELLANGIQPFVTLFHWDLPQ
|
|
FT VLEDEYGGFLNSGVINDFRDYTDLCFKEFGDRVRYWSTLNEPWVFSNSGYALGTNAPGR
|
|
FT CSASNVAKPGDSGTGPYIVTHNQILAHAEAVHVYKTKYQAYQKGKIGITLVSNWLMPLD
|
|
FT DNSIPDIKAAERSLDFQFGLFMEQLTTGDYSKSMRRIVKNRLPKFSKFESSLVNGSFDF
|
|
FT IGINYYSSSYISNAPSHGNAKPSYSTNPMTNISFEKHGIPLGPRAASIWIYVYPYMFIQ
|
|
FT EDFEIFCYILKINITILQFSITENGMNEFNDATLPVEEALLNTYRIDYYYRHLYYIRSA
|
|
FT IRAGSNVKGFYAWSFLDCNEWFAGFTVRFGLNFVD"
|
|
FT mRNA 1..1859
|
|
FT /experiment="experimental evidence, no additional details
|
|
FT recorded"
|
|
XX
|
|
SQ Sequence 1859 BP; 609 A; 314 C; 355 G; 581 T; 0 other;
|
|
aaacaaacca aatatggatt ttattgtagc catatttgct ctgtttgtta ttagctcatt 60
|
|
cacaattact tccacaaatg cagttgaagc ttctactctt cttgacatag gtaacctgag 120
|
|
tcggagcagt tttcctcgtg gcttcatctt tggtgctgga tcttcagcat accaatttga 180
|
|
aggtgcagta aacgaaggcg gtagaggacc aagtatttgg gataccttca cccataaata 240
|
|
tccagaaaaa ataagggatg gaagcaatgc agacatcacg gttgaccaat atcaccgcta 300
|
|
caaggaagat gttgggatta tgaaggatca aaatatggat tcgtatagat tctcaatctc 360
|
|
ttggccaaga atactcccaa agggaaagtt gagcggaggc ataaatcacg aaggaatcaa 420
|
|
atattacaac aaccttatca acgaactatt ggctaacggt atacaaccat ttgtaactct 480
|
|
ttttcattgg gatcttcccc aagtcttaga agatgagtat ggtggtttct taaactccgg 540
|
|
tgtaataaat gattttcgag actatacgga tctttgcttc aaggaatttg gagatagagt 600
|
|
gaggtattgg agtactctaa atgagccatg ggtgtttagc aattctggat atgcactagg 660
|
|
aacaaatgca ccaggtcgat gttcggcctc caacgtggcc aagcctggtg attctggaac 720
|
|
aggaccttat atagttacac acaatcaaat tcttgctcat gcagaagctg tacatgtgta 780
|
|
taagactaaa taccaggcat atcaaaaggg aaagataggc ataacgttgg tatctaactg 840
|
|
gttaatgcca cttgatgata atagcatacc agatataaag gctgccgaga gatcacttga 900
|
|
cttccaattt ggattgttta tggaacaatt aacaacagga gattattcta agagcatgcg 960
|
|
gcgtatagtt aaaaaccgat tacctaagtt ctcaaaattc gaatcaagcc tagtgaatgg 1020
|
|
ttcatttgat tttattggta taaactatta ctcttctagt tatattagca atgccccttc 1080
|
|
acatggcaat gccaaaccca gttactcaac aaatcctatg accaatattt catttgaaaa 1140
|
|
acatgggata cccttaggtc caagggctgc ttcaatttgg atatatgttt atccatatat 1200
|
|
gtttatccaa gaggacttcg agatcttttg ttacatatta aaaataaata taacaatcct 1260
|
|
gcaattttca atcactgaaa atggtatgaa tgaattcaac gatgcaacac ttccagtaga 1320
|
|
agaagctctt ttgaatactt acagaattga ttactattac cgtcacttat actacattcg 1380
|
|
ttctgcaatc agggctggct caaatgtgaa gggtttttac gcatggtcat ttttggactg 1440
|
|
taatgaatgg tttgcaggct ttactgttcg ttttggatta aactttgtag attagaaaga 1500
|
|
tggattaaaa aggtacccta agctttctgc ccaatggtac aagaactttc tcaaaagaaa 1560
|
|
ctagctagta ttattaaaag aactttgtag tagattacag tacatcgttt gaagttgagt 1620
|
|
tggtgcacct aattaaataa aagaggttac tcttaacata tttttaggcc attcgttgtg 1680
|
|
aagttgttag gctgttattt ctattatact atgttgtagt aataagtgca ttgttgtacc 1740
|
|
agaagctatg atcataacta taggttgatc cttcatgtat cagtttgatg ttgagaatac 1800
|
|
tttgaattaa aagtcttttt ttattttttt aaaaaaaaaa aaaaaaaaaa aaaaaaaaa 1859
|
|
//
|
|
"""
|
|
|
|
print("GenBank CDS Iteration")
|
|
print("=====================")
|
|
|
|
g = GenBankScanner()
|
|
for record in g.parse_cds_features(StringIO(gbk_example)):
|
|
print(record)
|
|
|
|
g = GenBankScanner()
|
|
for record in g.parse_cds_features(StringIO(gbk_example2),
|
|
tags2id=('gene', 'locus_tag', 'product')):
|
|
print(record)
|
|
|
|
g = GenBankScanner()
|
|
for record in g.parse_cds_features(StringIO(gbk_example + "\n" + gbk_example2),
|
|
tags2id=('gene', 'locus_tag', 'product')):
|
|
print(record)
|
|
|
|
print("")
|
|
print("GenBank Iteration")
|
|
print("=================")
|
|
g = GenBankScanner()
|
|
for record in g.parse_records(StringIO(gbk_example), do_features=False):
|
|
print("%s %s %s" % (record.id, record.name, record.description))
|
|
print(record.seq)
|
|
|
|
g = GenBankScanner()
|
|
for record in g.parse_records(StringIO(gbk_example), do_features=True):
|
|
print("%s %s %s" % (record.id, record.name, record.description))
|
|
print(record.seq)
|
|
|
|
g = GenBankScanner()
|
|
for record in g.parse_records(StringIO(gbk_example2), do_features=False):
|
|
print("%s %s %s" % (record.id, record.name, record.description))
|
|
print(record.seq)
|
|
|
|
g = GenBankScanner()
|
|
for record in g.parse_records(StringIO(gbk_example2), do_features=True):
|
|
print("%s %s %s" % (record.id, record.name, record.description))
|
|
print(record.seq)
|
|
|
|
print("")
|
|
print("EMBL CDS Iteration")
|
|
print("==================")
|
|
|
|
e = EmblScanner()
|
|
for record in e.parse_cds_features(StringIO(embl_example)):
|
|
print(record)
|
|
|
|
print("")
|
|
print("EMBL Iteration")
|
|
print("==============")
|
|
e = EmblScanner()
|
|
for record in e.parse_records(StringIO(embl_example), do_features=True):
|
|
print("%s %s %s" % (record.id, record.name, record.description))
|
|
print(record.seq)
|