mirror of
https://github.com/biopython/biopython.git
synced 2025-11-11 22:44:31 +08:00
413 lines
17 KiB
Python
413 lines
17 KiB
Python
# Copyright 2012 Lenna X. Peterson (arklenna@gmail.com).
|
|
# All rights reserved.
|
|
#
|
|
# This file is part of the Biopython distribution and governed by your
|
|
# choice of the "Biopython License Agreement" or the "BSD 3-Clause License".
|
|
# Please see the LICENSE file that should have been included as part of this
|
|
# package.
|
|
#
|
|
# Tests adapted from test_PDB.py
|
|
|
|
"""Unit tests for the MMCIF portion of the Bio.PDB module."""
|
|
|
|
import tempfile
|
|
import unittest
|
|
import warnings
|
|
|
|
try:
|
|
import numpy as np
|
|
from numpy import dot # Missing on old PyPy's micronumpy
|
|
|
|
del dot
|
|
from numpy.linalg import det # Missing in PyPy 2.0 numpypy
|
|
from numpy.linalg import svd # Missing in PyPy 2.0 numpypy
|
|
except ImportError:
|
|
from Bio import MissingPythonDependencyError
|
|
|
|
raise MissingPythonDependencyError(
|
|
"Install NumPy if you want to use Bio.PDB."
|
|
) from None
|
|
|
|
|
|
from Bio.PDB import CaPPBuilder
|
|
from Bio.PDB import PDBIO
|
|
from Bio.PDB import PDBParser
|
|
from Bio.PDB import PPBuilder
|
|
from Bio.PDB.MMCIFParser import FastMMCIFParser
|
|
from Bio.PDB.MMCIFParser import MMCIFParser
|
|
from Bio.PDB.PDBExceptions import PDBConstructionWarning
|
|
from Bio.PDB.PDBExceptions import PDBIOException
|
|
from Bio.Seq import Seq
|
|
|
|
|
|
class ParseReal(unittest.TestCase):
|
|
"""Testing with real CIF file(s)."""
|
|
|
|
def test_parsers(self):
|
|
"""Extract polypeptides from 1A80."""
|
|
parser = MMCIFParser()
|
|
fast_parser = FastMMCIFParser()
|
|
|
|
structure = parser.get_structure("example", "PDB/1A8O.cif")
|
|
f_structure = fast_parser.get_structure("example", "PDB/1A8O.cif")
|
|
|
|
self.assertEqual(len(structure), 1)
|
|
self.assertEqual(len(f_structure), 1)
|
|
|
|
parser_lab_res = MMCIFParser(auth_residues=False, QUIET=True)
|
|
fast_parser_lab_res = FastMMCIFParser(auth_residues=False, QUIET=True)
|
|
parser_lab_chain = MMCIFParser(auth_chains=False, QUIET=True)
|
|
fast_parser_lab_chain = FastMMCIFParser(auth_chains=False, QUIET=True)
|
|
|
|
structure_lr = parser_lab_res.get_structure("example", "PDB/1A8O.cif")
|
|
f_structure_lr = fast_parser_lab_res.get_structure("example", "PDB/1A8O.cif")
|
|
structure_lc = parser_lab_chain.get_structure("example", "PDB/1A8O.cif")
|
|
f_structure_lc = fast_parser_lab_chain.get_structure("example", "PDB/1A8O.cif")
|
|
|
|
self.assertEqual(len(list(structure_lr.get_atoms())), 556)
|
|
self.assertEqual(len(list(f_structure_lr.get_atoms())), 556)
|
|
self.assertEqual(len(list(structure_lc.get_atoms())), 644)
|
|
self.assertEqual(len(list(f_structure_lc.get_atoms())), 644)
|
|
|
|
for ppbuild in [PPBuilder(), CaPPBuilder()]:
|
|
# ==========================================================
|
|
# Check that serial_num (model column) is stored properly
|
|
self.assertEqual(structure[0].serial_num, 1)
|
|
self.assertEqual(f_structure[0].serial_num, structure[0].serial_num)
|
|
|
|
# First try allowing non-standard amino acids,
|
|
polypeptides = ppbuild.build_peptides(structure[0], False)
|
|
f_polypeptides = ppbuild.build_peptides(f_structure[0], False)
|
|
|
|
self.assertEqual(len(polypeptides), 1)
|
|
self.assertEqual(len(f_polypeptides), 1)
|
|
|
|
pp = polypeptides[0]
|
|
f_pp = f_polypeptides[0]
|
|
|
|
# Check the start and end positions
|
|
self.assertEqual(pp[0].get_id()[1], 151)
|
|
self.assertEqual(pp[-1].get_id()[1], 220)
|
|
|
|
self.assertEqual(f_pp[0].get_id()[1], 151)
|
|
self.assertEqual(f_pp[-1].get_id()[1], 220)
|
|
|
|
# Check the sequence
|
|
s = pp.get_sequence()
|
|
f_s = f_pp.get_sequence()
|
|
|
|
self.assertEqual(s, f_s) # enough to test this
|
|
|
|
self.assertIsInstance(s, Seq)
|
|
|
|
# Here non-standard MSE are shown as M
|
|
self.assertEqual(
|
|
"MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQ"
|
|
"NANPDCKTILKALGPGATLEEMMTACQG",
|
|
s,
|
|
)
|
|
|
|
# ==========================================================
|
|
# Now try strict version with only standard amino acids
|
|
# Should ignore MSE 151 at start, and then break the chain
|
|
# at MSE 185, and MSE 214,215
|
|
polypeptides = ppbuild.build_peptides(structure[0], True)
|
|
self.assertEqual(len(polypeptides), 3)
|
|
|
|
# First fragment
|
|
pp = polypeptides[0]
|
|
self.assertEqual(pp[0].get_id()[1], 152)
|
|
self.assertEqual(pp[-1].get_id()[1], 184)
|
|
s = pp.get_sequence()
|
|
self.assertIsInstance(s, Seq)
|
|
self.assertEqual("DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW", s)
|
|
|
|
# Second fragment
|
|
pp = polypeptides[1]
|
|
self.assertEqual(pp[0].get_id()[1], 186)
|
|
self.assertEqual(pp[-1].get_id()[1], 213)
|
|
s = pp.get_sequence()
|
|
self.assertIsInstance(s, Seq)
|
|
self.assertEqual("TETLLVQNANPDCKTILKALGPGATLEE", s)
|
|
|
|
# Third fragment
|
|
pp = polypeptides[2]
|
|
self.assertEqual(pp[0].get_id()[1], 216)
|
|
self.assertEqual(pp[-1].get_id()[1], 220)
|
|
s = pp.get_sequence()
|
|
self.assertIsInstance(s, Seq)
|
|
self.assertEqual("TACQG", s)
|
|
|
|
s_atoms = list(structure.get_atoms())
|
|
f_atoms = list(f_structure.get_atoms())
|
|
|
|
for atoms in [s_atoms, f_atoms]:
|
|
self.assertEqual(len(atoms), 644)
|
|
atom_names = ["N", "CA", "C", "O", "CB"]
|
|
self.assertEqual([a.get_name() for a in atoms[:5]], atom_names)
|
|
self.assertEqual([a.get_id() for a in atoms[:5]], atom_names)
|
|
self.assertEqual([a.get_fullname() for a in atoms[:5]], atom_names)
|
|
self.assertEqual(
|
|
[a.get_occupancy() for a in atoms[:5]], [1.0, 1.0, 1.0, 1.0, 1.0]
|
|
)
|
|
self.assertIsInstance(atoms[0].get_coord(), np.ndarray)
|
|
coord = np.array([19.594, 32.367, 28.012], dtype=np.float32)
|
|
np.testing.assert_array_equal(atoms[0].get_coord(), coord)
|
|
|
|
self.assertEqual(atoms[0].get_bfactor(), 18.03)
|
|
for atom in atoms:
|
|
self.assertIsNone(atom.get_anisou())
|
|
|
|
def test_with_anisotrop(self):
|
|
parser = MMCIFParser()
|
|
fast_parser = FastMMCIFParser()
|
|
|
|
structure = parser.get_structure("example", "PDB/4CUP.cif")
|
|
f_structure = fast_parser.get_structure("example", "PDB/4CUP.cif")
|
|
|
|
self.assertEqual(len(structure), 1)
|
|
self.assertEqual(len(f_structure), 1)
|
|
|
|
s_atoms = list(structure.get_atoms())
|
|
f_atoms = list(f_structure.get_atoms())
|
|
|
|
self.assertEqual(len(s_atoms), len(f_atoms))
|
|
|
|
for atoms in [s_atoms, f_atoms]:
|
|
atom_names = ["N", "CA", "C", "O", "CB"]
|
|
self.assertEqual([a.get_name() for a in atoms[:5]], atom_names)
|
|
self.assertEqual([a.get_id() for a in atoms[:5]], atom_names)
|
|
self.assertEqual([a.get_fullname() for a in atoms[:5]], atom_names)
|
|
self.assertEqual(
|
|
[a.get_occupancy() for a in atoms[:5]], [1.0, 1.0, 1.0, 1.0, 1.0]
|
|
)
|
|
self.assertIsInstance(atoms[0].get_coord(), np.ndarray)
|
|
coord = np.array([50.346, 19.287, 17.288], dtype=np.float32)
|
|
np.testing.assert_array_equal(atoms[0].get_coord(), coord)
|
|
self.assertEqual(atoms[0].get_bfactor(), 32.02)
|
|
|
|
ansiou = np.array(
|
|
[0.4738, -0.0309, -0.0231, 0.4524, 0.0036, 0.2904], dtype=np.float32
|
|
)
|
|
np.testing.assert_array_equal(atoms[0].get_anisou(), ansiou)
|
|
ansiou = np.array(
|
|
[1.1242, 0.2942, -0.0995, 1.1240, -0.1088, 0.8221], dtype=np.float32
|
|
)
|
|
atom_937 = list(f_structure[0]["A"])[114]["CB"]
|
|
np.testing.assert_array_equal(atom_937.get_anisou(), ansiou)
|
|
|
|
def testModels(self):
|
|
"""Test file with multiple models."""
|
|
parser = MMCIFParser(QUIET=1)
|
|
f_parser = FastMMCIFParser(QUIET=1)
|
|
with warnings.catch_warnings():
|
|
warnings.simplefilter("ignore", PDBConstructionWarning)
|
|
structure = parser.get_structure("example", "PDB/1LCD.cif")
|
|
f_structure = f_parser.get_structure("example", "PDB/1LCD.cif")
|
|
|
|
self.assertEqual(len(structure), 3)
|
|
self.assertEqual(len(f_structure), 3)
|
|
|
|
for ppbuild in [PPBuilder(), CaPPBuilder()]:
|
|
# ==========================================================
|
|
# Check that serial_num (model column) is stored properly
|
|
self.assertEqual(structure[0].serial_num, 1)
|
|
self.assertEqual(structure[1].serial_num, 2)
|
|
self.assertEqual(structure[2].serial_num, 3)
|
|
# First try allowing non-standard amino acids,
|
|
polypeptides = ppbuild.build_peptides(structure[0], False)
|
|
self.assertEqual(len(polypeptides), 1)
|
|
pp = polypeptides[0]
|
|
# Check the start and end positions
|
|
self.assertEqual(pp[0].get_id()[1], 1)
|
|
self.assertEqual(pp[-1].get_id()[1], 51)
|
|
# Check the sequence
|
|
s = pp.get_sequence()
|
|
self.assertIsInstance(s, Seq)
|
|
# Here non-standard MSE are shown as M
|
|
self.assertEqual("MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR", s)
|
|
# ==========================================================
|
|
# Now try strict version with only standard amino acids
|
|
polypeptides = ppbuild.build_peptides(structure[0], True)
|
|
self.assertEqual(len(polypeptides), 1)
|
|
pp = polypeptides[0]
|
|
# Check the start and end positions
|
|
self.assertEqual(pp[0].get_id()[1], 1)
|
|
self.assertEqual(pp[-1].get_id()[1], 51)
|
|
# Check the sequence
|
|
s = pp.get_sequence()
|
|
self.assertIsInstance(s, Seq)
|
|
self.assertEqual("MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR", s)
|
|
|
|
# This structure contains several models with multiple lengths.
|
|
# The tests were failing.
|
|
structure = parser.get_structure("example", "PDB/2OFG.cif")
|
|
self.assertEqual(len(structure), 3)
|
|
|
|
def test_insertions(self):
|
|
"""Test file with residue insertion codes."""
|
|
parser = MMCIFParser(QUIET=1)
|
|
with warnings.catch_warnings():
|
|
warnings.simplefilter("ignore", PDBConstructionWarning)
|
|
structure = parser.get_structure("example", "PDB/4ZHL.cif")
|
|
for ppbuild in [PPBuilder(), CaPPBuilder()]:
|
|
# First try allowing non-standard amino acids,
|
|
polypeptides = ppbuild.build_peptides(structure[0], False)
|
|
self.assertEqual(len(polypeptides), 2)
|
|
pp = polypeptides[0]
|
|
# Check the start and end positions (first segment only)
|
|
self.assertEqual(pp[0].get_id()[1], 16)
|
|
self.assertEqual(pp[-1].get_id()[1], 244)
|
|
# Check the sequence
|
|
refseq = (
|
|
"IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGR"
|
|
"SRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMY"
|
|
"NDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQW"
|
|
"KTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE"
|
|
)
|
|
s = pp.get_sequence()
|
|
self.assertIsInstance(s, Seq)
|
|
self.assertEqual(refseq, s)
|
|
|
|
def test_filehandle(self):
|
|
"""Test if the parser can handle file handle as well as filename."""
|
|
parser = MMCIFParser()
|
|
structure = parser.get_structure("example", "PDB/1A8O.cif")
|
|
self.assertEqual(len(structure), 1)
|
|
|
|
with open("PDB/1A8O.cif") as handle:
|
|
structure = parser.get_structure("example", handle)
|
|
self.assertEqual(len(structure), 1)
|
|
|
|
def test_point_mutations_main(self):
|
|
"""Test if MMCIFParser parse point mutations correctly."""
|
|
self._run_point_mutation_tests(MMCIFParser(QUIET=True))
|
|
|
|
def test_point_mutations_fast(self):
|
|
"""Test if FastMMCIFParser can parse point mutations correctly."""
|
|
self._run_point_mutation_tests(FastMMCIFParser(QUIET=True))
|
|
|
|
def _run_point_mutation_tests(self, parser):
|
|
"""Shared test code for testing point mutations."""
|
|
structure = parser.get_structure("example", "PDB/3JQH.cif")
|
|
|
|
# Residue 1 and 15 should be disordered.
|
|
res_1 = structure[0]["A"][1]
|
|
res_15 = structure[0]["A"][15]
|
|
|
|
# Cursory check -- this would be true even if the residue just
|
|
# contained some disordered atoms.
|
|
self.assertTrue(res_1.is_disordered(), "Residue 1 is disordered")
|
|
self.assertTrue(res_15.is_disordered(), "Residue 15 is disordered")
|
|
|
|
# Check a non-mutated residue just to be sure we didn't break the
|
|
# parser and cause everything to be disordered.
|
|
self.assertFalse(
|
|
structure[0]["A"][13].is_disordered(), "Residue 13 is not disordered"
|
|
)
|
|
|
|
# Check that the residue types were parsed correctly.
|
|
self.assertEqual(
|
|
set(res_1.disordered_get_id_list()),
|
|
{"PRO", "SER"},
|
|
"Residue 1 is proline/serine",
|
|
)
|
|
self.assertEqual(
|
|
set(res_15.disordered_get_id_list()),
|
|
{"ARG", "GLN", "GLU"},
|
|
"Residue 15 is arginine/glutamine/glutamic acid",
|
|
)
|
|
|
|
# Quickly check that we can switch between residues and that the
|
|
# correct set of residues was parsed.
|
|
res_1.disordered_select("PRO")
|
|
self.assertAlmostEqual(
|
|
res_1["CA"].get_occupancy(), 0.83, 2, "Residue 1 proline occupancy correcy"
|
|
)
|
|
|
|
res_1.disordered_select("SER")
|
|
self.assertAlmostEqual(
|
|
res_1["CA"].get_occupancy(), 0.17, 2, "Residue 1 serine occupancy correcy"
|
|
)
|
|
|
|
def test_header(self):
|
|
"""Test if the parser populates header data."""
|
|
parser = MMCIFParser(QUIET=1)
|
|
|
|
# test default values
|
|
structure = parser.get_structure("example", "PDB/a_structure.cif")
|
|
self.assertEqual("", structure.header["idcode"])
|
|
self.assertEqual("", structure.header["head"])
|
|
self.assertEqual("", structure.header["deposition_date"])
|
|
self.assertEqual("", structure.header["structure_method"])
|
|
self.assertIsNone(structure.header["resolution"])
|
|
|
|
# test extracting fields
|
|
structure = parser.get_structure("example", "PDB/1A8O.cif")
|
|
self.assertEqual("1A8O", structure.header["idcode"])
|
|
self.assertEqual("Viral protein", structure.header["head"])
|
|
self.assertEqual("", structure.header["deposition_date"])
|
|
self.assertEqual("X-RAY DIFFRACTION", structure.header["structure_method"])
|
|
self.assertEqual(1.7, structure.header["resolution"])
|
|
|
|
# test not confused by '.' or '?'
|
|
structure = parser.get_structure("example", "PDB/1SSU_mod.cif")
|
|
# self.assertIsNone(structure.header["resolution"])
|
|
self.assertEqual(4.1, structure.header["resolution"])
|
|
|
|
|
|
class CIFtoPDB(unittest.TestCase):
|
|
"""Testing conversion between formats: CIF to PDB."""
|
|
|
|
def test_conversion(self):
|
|
"""Parse 1LCD.cif, write 1LCD.pdb, parse again and compare."""
|
|
cif_parser = MMCIFParser(QUIET=1)
|
|
cif_struct = cif_parser.get_structure("example", "PDB/1LCD.cif")
|
|
|
|
pdb_writer = PDBIO()
|
|
pdb_writer.set_structure(cif_struct)
|
|
filenumber, filename = tempfile.mkstemp()
|
|
pdb_writer.save(filename)
|
|
|
|
pdb_parser = PDBParser(QUIET=1)
|
|
pdb_struct = pdb_parser.get_structure("example_pdb", filename)
|
|
|
|
# comparisons
|
|
self.assertEqual(len(pdb_struct), len(cif_struct))
|
|
|
|
pdb_atom_names = [a.name for a in pdb_struct.get_atoms()]
|
|
cif_atom_names = [a.name for a in cif_struct.get_atoms()]
|
|
self.assertEqual(pdb_atom_names, cif_atom_names)
|
|
|
|
pdb_atom_elems = [a.element for a in pdb_struct.get_atoms()]
|
|
cif_atom_elems = [a.element for a in cif_struct.get_atoms()]
|
|
self.assertEqual(pdb_atom_elems, cif_atom_elems)
|
|
|
|
def test_conversion_not_preserve_numbering(self):
|
|
"""Convert mmCIF to PDB and renumber atom serials."""
|
|
cif_parser = MMCIFParser(QUIET=1)
|
|
cif_struct = cif_parser.get_structure("example", "PDB/a_structure.cif")
|
|
|
|
pdb_writer = PDBIO()
|
|
pdb_writer.set_structure(cif_struct)
|
|
filenumber, filename = tempfile.mkstemp()
|
|
|
|
pdb_writer.save(filename, preserve_atom_numbering=False)
|
|
|
|
def test_conversion_preserve_numbering(self):
|
|
"""Convert mmCIF to PDB and preserve original serial numbering."""
|
|
cif_parser = MMCIFParser(QUIET=1)
|
|
cif_struct = cif_parser.get_structure("example", "PDB/a_structure.cif")
|
|
|
|
pdb_writer = PDBIO()
|
|
pdb_writer.set_structure(cif_struct)
|
|
filenumber, filename = tempfile.mkstemp()
|
|
|
|
with self.assertRaises(PDBIOException):
|
|
pdb_writer.save(filename, preserve_atom_numbering=True)
|
|
|
|
|
|
if __name__ == "__main__":
|
|
runner = unittest.TextTestRunner(verbosity=2)
|
|
unittest.main(testRunner=runner)
|