# Copyright 2000-2002 Andrew Dalke. All rights reserved. # Copyright 2002-2004 Brad Chapman. All rights reserved. # Copyright 2006-2023 by Peter Cock. All rights reserved. # Copyright 2020 by Michael R. Crusoe # # This file is part of the Biopython distribution and governed by your # choice of the "Biopython License Agreement" or the "BSD 3-Clause License". # Please see the LICENSE file that should have been included as part of this # package. """Represent a Sequence Record, a sequence with annotation.""" # NEEDS TO BE SYNCH WITH THE REST OF BIOPYTHON AND BIOPERL # In particular, the SeqRecord and BioSQL.BioSeq.DBSeqRecord classes # need to be in sync (this is the BioSQL "Database SeqRecord"). import numbers from typing import Any from typing import cast from collections.abc import Iterator from typing import NoReturn from typing import Optional from typing import overload from collections.abc import Sequence from typing import TYPE_CHECKING from typing import Union from Bio import StreamModeError from Bio.Seq import MutableSeq from Bio.Seq import Seq from Bio.Seq import UndefinedSequenceError if TYPE_CHECKING: from Bio.SeqFeature import SeqFeature _NO_SEQRECORD_COMPARISON = "SeqRecord comparison is deliberately not implemented. Explicitly compare the attributes of interest." class _RestrictedDict(dict[str, Sequence[Any]]): """Dict which only allows sequences of given length as values (PRIVATE). This simple subclass of the Python dictionary is used in the SeqRecord object for holding per-letter-annotations. This class is intended to prevent simple errors by only allowing python sequences (e.g. lists, strings and tuples) to be stored, and only if their length matches that expected (the length of the SeqRecord's seq object). It cannot however prevent the entries being edited in situ (for example appending entries to a list). >>> x = _RestrictedDict(5) >>> x["test"] = "hello" >>> x {'test': 'hello'} Adding entries which don't have the expected length are blocked: >>> x["test"] = "hello world" Traceback (most recent call last): ... TypeError: Any per-letter annotation should be a Python sequence (list, tuple or string) of the same length as the biological sequence, here 5. The expected length is stored as a private attribute, >>> x._length 5 In order that the SeqRecord (and other objects using this class) can be pickled, for example for use in the multiprocessing library, we need to be able to pickle the restricted dictionary objects. Using the default protocol, which is 3 on Python 3, >>> import pickle >>> y = pickle.loads(pickle.dumps(x)) >>> y {'test': 'hello'} >>> y._length 5 Using the highest protocol, which is 4 on Python 3, >>> import pickle >>> z = pickle.loads(pickle.dumps(x, pickle.HIGHEST_PROTOCOL)) >>> z {'test': 'hello'} >>> z._length 5 """ def __init__(self, length: int) -> None: """Create an EMPTY restricted dictionary.""" dict.__init__(self) self._length = int(length) def __setitem__(self, key: str, value: Sequence[Any]) -> None: # The check hasattr(self, "_length") is to cope with pickle protocol 2 # I couldn't seem to avoid this with __getstate__ and __setstate__ if ( not hasattr(value, "__len__") or not hasattr(value, "__getitem__") or (hasattr(self, "_length") and len(value) != self._length) ): raise TypeError( "Any per-letter annotation should be a Python sequence " "(list, tuple or string) of the same length as the " f"biological sequence, here {self._length}." ) dict.__setitem__(self, key, value) def update(self, new_dict): # Force this to go via our strict __setitem__ method for key, value in new_dict.items(): self[key] = value class SeqRecord: """A SeqRecord object holds a sequence and information about it. Main attributes: - id - Identifier such as a locus tag (string) - seq - The sequence itself (Seq object or similar) Additional attributes: - name - Sequence name, e.g. gene name (string) - description - Additional text (string) - dbxrefs - List of database cross references (list of strings) - features - Any (sub)features defined (list of SeqFeature objects) - annotations - Further information about the whole sequence (dictionary). Most entries are strings, or lists of strings. - letter_annotations - Per letter/symbol annotation (restricted dictionary). This holds Python sequences (lists, strings or tuples) whose length matches that of the sequence. A typical use would be to hold a list of integers representing sequencing quality scores, or a string representing the secondary structure. You will typically use Bio.SeqIO to read in sequences from files as SeqRecord objects. However, you may want to create your own SeqRecord objects directly (see the __init__ method for further details): >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"), ... id="YP_025292.1", name="HokC", ... description="toxic membrane protein") >>> print(record) ID: YP_025292.1 Name: HokC Description: toxic membrane protein Number of features: 0 Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF') If you want to save SeqRecord objects to a sequence file, use Bio.SeqIO for this. For the special case where you want the SeqRecord turned into a string in a particular file format there is a format method which uses Bio.SeqIO internally: >>> print(record.format("fasta")) >YP_025292.1 toxic membrane protein MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF You can also do things like slicing a SeqRecord, checking its length, etc >>> len(record) 44 >>> edited = record[:10] + record[11:] >>> print(edited.seq) MKQHKAMIVAIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF >>> print(record.seq) MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF """ _AnnotationsDictValue = Union[str, int] _AnnotationsDict = dict[str, _AnnotationsDictValue] annotations: _AnnotationsDict dbxrefs: list[str] _per_letter_annotations: _RestrictedDict | None def __init__( self, seq: Union["Seq", "MutableSeq"] | None, id: str | None = "", name: str = "", description: str = "", dbxrefs: list[str] | None = None, features: list["SeqFeature"] | None = None, annotations: _AnnotationsDict | None = None, letter_annotations: dict[str, Sequence[Any]] | None = None, ) -> None: """Create a SeqRecord. Arguments: - seq - Sequence, required (Seq or MutableSeq) - id - Sequence identifier, recommended (string) - name - Sequence name, optional (string) - description - Sequence description, optional (string) - dbxrefs - Database cross references, optional (list of strings) - features - Any (sub)features, optional (list of SeqFeature objects) - annotations - Dictionary of annotations for the whole sequence - letter_annotations - Dictionary of per-letter-annotations, values should be strings, list or tuples of the same length as the full sequence. You will typically use Bio.SeqIO to read in sequences from files as SeqRecord objects. However, you may want to create your own SeqRecord objects directly. Note that while an id is optional, we strongly recommend you supply a unique id string for each record. This is especially important if you wish to write your sequences to a file. You can create a 'blank' SeqRecord object, and then populate the attributes later. """ if seq is not None and not isinstance(seq, (Seq, MutableSeq)): raise TypeError("seq argument should be a Seq or MutableSeq object") if id is not None and not isinstance(id, str): # Lots of existing code uses id=None... this may be a bad idea. raise TypeError("id argument should be a string") if not isinstance(name, str): raise TypeError("name argument should be a string") if not isinstance(description, str): raise TypeError("description argument should be a string") self._seq = seq self.id = id self.name = name self.description = description # database cross references (for the whole sequence) if dbxrefs is None: dbxrefs = [] elif not isinstance(dbxrefs, list): raise TypeError("dbxrefs argument should be a list (of strings)") self.dbxrefs = dbxrefs # annotations about the whole sequence if annotations is None: annotations = {} elif not isinstance(annotations, dict): raise TypeError("annotations argument must be a dict or None") self.annotations = annotations self._per_letter_annotations = None if letter_annotations is not None: # This will be handled via the property set function, which will # turn this into a _RestrictedDict and thus ensure all the values # in the dict are the right length self.letter_annotations = letter_annotations # annotations about parts of the sequence if features is None: features = [] elif not isinstance(features, list): raise TypeError( "features argument should be a list (of SeqFeature objects)" ) self.features = features @property def letter_annotations(self) -> dict[str, Sequence[Any]]: """Dictionary of per-letter-annotation for the sequence. For example, this can hold quality scores used in FASTQ or QUAL files. Consider this example using Bio.SeqIO to read in an example Solexa variant FASTQ file as a SeqRecord: >>> from Bio import SeqIO >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa") >>> print("%s %s" % (record.id, record.seq)) slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN >>> print(list(record.letter_annotations)) ['solexa_quality'] >>> print(record.letter_annotations["solexa_quality"]) [40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0, -1, -2, -3, -4, -5] The letter_annotations get sliced automatically if you slice the parent SeqRecord, for example taking the last ten bases: >>> sub_record = record[-10:] >>> print("%s %s" % (sub_record.id, sub_record.seq)) slxa_0001_1_0001_01 ACGTNNNNNN >>> print(sub_record.letter_annotations["solexa_quality"]) [4, 3, 2, 1, 0, -1, -2, -3, -4, -5] Any python sequence (i.e. list, tuple or string) can be recorded in the SeqRecord's letter_annotations dictionary as long as the length matches that of the SeqRecord's sequence. e.g. >>> len(sub_record.letter_annotations) 1 >>> sub_record.letter_annotations["dummy"] = "abcdefghij" >>> len(sub_record.letter_annotations) 2 You can delete entries from the letter_annotations dictionary as usual: >>> del sub_record.letter_annotations["solexa_quality"] >>> sub_record.letter_annotations {'dummy': 'abcdefghij'} You can completely clear the dictionary easily as follows: >>> sub_record.letter_annotations = {} >>> sub_record.letter_annotations {} Note that if replacing the record's sequence with a sequence of a different length you must first clear the letter_annotations dict. """ if self._per_letter_annotations is None: length = 0 if self.seq is None else len(self.seq) self._per_letter_annotations = _RestrictedDict(length=length) return self._per_letter_annotations # TODO - Just make this a read only property? @letter_annotations.setter def letter_annotations(self, value: dict[str, Sequence[Any]]) -> None: if not isinstance(value, dict): raise TypeError( "The per-letter-annotations should be a (restricted) dictionary." ) # Turn this into a restricted-dictionary (and check the entries) length = 0 if self.seq is None else len(self.seq) if any(len(val) != length for val in value.values()): raise ValueError( f"The per-letter-annotations have the same length as the sequence, but found: \n {','.join([f'{key}={val}' for key, val in value.items() if len(val) != length])}" ) if self._per_letter_annotations is None: self._per_letter_annotations = _RestrictedDict(length=length) else: self._per_letter_annotations.clear() dict.update(self._per_letter_annotations, value) # type: ignore @property def seq(self) -> Union["Seq", "MutableSeq"] | None: """The sequence itself, as a Seq or MutableSeq object.""" return self._seq @seq.setter def seq(self, value: Union["Seq", "MutableSeq"]) -> None: # Adding this here for users who are not type-checking their code. if value is not None and not isinstance(value, (Seq, MutableSeq)): raise TypeError("seq must be a Seq or MutableSeq object") # TODO - Add a deprecation warning that the seq should be write only? if self._per_letter_annotations: if len(self) != len(value): # TODO - Make this a warning? Silently empty the dictionary? raise ValueError("You must empty the letter annotations first!") else: # Leave the existing per letter annotations unchanged: self._seq = value else: self._seq = value # Reset the (empty) letter annotations dict with new length: length = 0 if self.seq is None else len(self.seq) self._per_letter_annotations = _RestrictedDict(length=length) @classmethod def _from_validated( cls, seq: Seq | MutableSeq | None, id: str | None = "", name: str = "", description: str = "", dbxrefs: list[str] | None = None, features: list["SeqFeature"] | None = None, annotations: dict[str, str | int] | None = None, letter_annotations: dict[str, Sequence] | None = None, ) -> "SeqRecord": """Faster constructor for post-validated data like copies or validated parsed data""" if cls is not SeqRecord: # If we subclassed, we'll default to that class's initializer just to be careful return cls( seq, id, name, description, dbxrefs, features, annotations, letter_annotations, ) inst = cls.__new__(cls) inst._seq = seq inst.id = id inst.name = name inst.description = description if dbxrefs is None: dbxrefs = [] inst.dbxrefs = dbxrefs if features is None: features = [] inst.features = features if annotations is None: annotations = {} inst.annotations = annotations inst._per_letter_annotations = None if letter_annotations is not None: length = 0 if seq is None else len(seq) inst._per_letter_annotations = _RestrictedDict(length=length) dict.update(inst._per_letter_annotations, letter_annotations) # type: ignore return inst @overload def __getitem__(self, index: int) -> str: ... @overload def __getitem__(self, index: slice) -> "SeqRecord": ... def __getitem__(self, index): """Return a sub-sequence or an individual letter. Slicing, e.g. my_record[5:10], returns a new SeqRecord for that sub-sequence with some annotation preserved as follows: * The name, id and description are kept as-is. * Any per-letter-annotations are sliced to match the requested sub-sequence. * Unless a stride is used, all those features which fall fully within the subsequence are included (with their locations adjusted accordingly). If you want to preserve any truncated features (e.g. GenBank/EMBL source features), you must explicitly add them to the new SeqRecord yourself. * With the exception of any molecule type, the annotations dictionary and the dbxrefs list are not used for the new SeqRecord, as in general they may not apply to the subsequence. If you want to preserve them, you must explicitly copy them to the new SeqRecord yourself. Using an integer index, e.g. my_record[5] is shorthand for extracting that letter from the sequence, my_record.seq[5]. For example, consider this short protein and its secondary structure as encoded by the PDB (e.g. H for alpha helices), plus a simple feature for its histidine self phosphorylation site: >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> from Bio.SeqFeature import SeqFeature, SimpleLocation >>> rec = SeqRecord(Seq("MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT" ... "EMMSEQDGYLAESINKDIEECNAIIEQFIDYLR"), ... id="1JOY", name="EnvZ", ... description="Homodimeric domain of EnvZ from E. coli") >>> rec.letter_annotations["secondary_structure"] = " S SSSSSSHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTT " >>> rec.features.append(SeqFeature(SimpleLocation(20, 21), ... type = "Site")) Now let's have a quick look at the full record, >>> print(rec) ID: 1JOY Name: EnvZ Description: Homodimeric domain of EnvZ from E. coli Number of features: 1 Per letter annotation for: secondary_structure Seq('MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEE...YLR') >>> rec.letter_annotations["secondary_structure"] ' S SSSSSSHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTT ' >>> print(rec.features[0].location) [20:21] Now let's take a sub sequence, here chosen as the first (fractured) alpha helix which includes the histidine phosphorylation site: >>> sub = rec[11:41] >>> print(sub) ID: 1JOY Name: EnvZ Description: Homodimeric domain of EnvZ from E. coli Number of features: 1 Per letter annotation for: secondary_structure Seq('RTLLMAGVSHDLRTPLTRIRLATEMMSEQD') >>> sub.letter_annotations["secondary_structure"] 'HHHHHTTTHHHHHHHHHHHHHHHHHHHHHH' >>> print(sub.features[0].location) [9:10] You can also of course omit the start or end values, for example to get the first ten letters only: >>> print(rec[:10]) ID: 1JOY Name: EnvZ Description: Homodimeric domain of EnvZ from E. coli Number of features: 0 Per letter annotation for: secondary_structure Seq('MAAGVKQLAD') Or for the last ten letters: >>> print(rec[-10:]) ID: 1JOY Name: EnvZ Description: Homodimeric domain of EnvZ from E. coli Number of features: 0 Per letter annotation for: secondary_structure Seq('IIEQFIDYLR') If you omit both, then you get a copy of the original record (although lacking the annotations and dbxrefs): >>> print(rec[:]) ID: 1JOY Name: EnvZ Description: Homodimeric domain of EnvZ from E. coli Number of features: 1 Per letter annotation for: secondary_structure Seq('MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEE...YLR') Finally, indexing with a simple integer is shorthand for pulling out that letter from the sequence directly: >>> rec[5] 'K' >>> rec.seq[5] 'K' """ if isinstance(index, numbers.Integral): # NOTE - The sequence level annotation like the id, name, etc # do not really apply to a single character. However, should # we try and expose any per-letter-annotation here? If so how? if self.seq is None: raise ValueError( "Seq in SeqRecord is None, it doesn't support indexing" ) return self.seq[index] elif isinstance(index, slice): if self.seq is None: raise ValueError("Seq in SeqRecord is None, we cannot slice it") parent_length = len(self) try: from BioSQL.BioSeq import DBSeqRecord biosql_available = True except ImportError: biosql_available = False if biosql_available and isinstance(self, DBSeqRecord): answer = SeqRecord._from_validated( self.seq[index], id=self.id, name=self.name, description=self.description, ) else: answer = self._from_validated( self.seq[index], id=self.id, name=self.name, description=self.description, ) # TODO - The description may no longer apply. # It would be safer to change it to something # generic like "edited" or the default value. # Don't copy the annotation dict and dbxefs list, # they may not apply to a subsequence. # answer.annotations = dict(self.annotations.items()) # answer.dbxrefs = self.dbxrefs[:] # TODO - Review this in light of adding SeqRecord objects? if "molecule_type" in self.annotations: # This will still apply, and we need it for GenBank/EMBL etc output answer.annotations["molecule_type"] = self.annotations["molecule_type"] # TODO - Cope with strides by generating ambiguous locations? start, stop, step = index.indices(parent_length) if step == 1: # Select relevant features, add them with shifted locations # assert str(self.seq)[index] == str(self.seq)[start:stop] for f in self.features: if f.location.ref or f.location.ref_db: # TODO - Implement this (with lots of tests)? import warnings warnings.warn( "When slicing SeqRecord objects, any " "SeqFeature referencing other sequences (e.g. " "from segmented GenBank records) are ignored." ) continue try: if start <= f.location.start and f.location.end <= stop: answer.features.append(f._shift(-start)) except TypeError: # Will fail on UnknownPosition pass # Slice all the values to match the sliced sequence # (this should also work with strides, even negative strides): for key, value in self.letter_annotations.items(): answer.letter_annotations[key] = value[index] return answer raise ValueError("Invalid index") def __iter__(self) -> Iterator[str]: """Iterate over the letters in the sequence. For example, using Bio.SeqIO to read in a protein FASTA file: >>> from Bio import SeqIO >>> record = SeqIO.read("Fasta/loveliesbleeding.pro", "fasta") >>> for amino in record: ... print(amino) ... if amino == "L": break X A G L >>> print(record.seq[3]) L This is just a shortcut for iterating over the sequence directly: >>> for amino in record.seq: ... print(amino) ... if amino == "L": break X A G L >>> print(record.seq[3]) L Note that this does not facilitate iteration together with any per-letter-annotation. However, you can achieve that using the python zip function on the record (or its sequence) and the relevant per-letter-annotation: >>> from Bio import SeqIO >>> rec = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa") >>> print("%s %s" % (rec.id, rec.seq)) slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN >>> print(list(rec.letter_annotations)) ['solexa_quality'] >>> for nuc, qual in zip(rec, rec.letter_annotations["solexa_quality"]): ... if qual > 35: ... print("%s %i" % (nuc, qual)) A 40 C 39 G 38 T 37 A 36 You may agree that using zip(rec.seq, ...) is more explicit than using zip(rec, ...) as shown above. """ if self._seq is None: raise ValueError("Seq in SeqRecord is None, can't iterate over it") return iter(self._seq) def __contains__(self, char: str) -> bool: """Implement the 'in' keyword, searches the sequence. e.g. >>> from Bio import SeqIO >>> record = SeqIO.read("Fasta/sweetpea.nu", "fasta") >>> "GAATTC" in record False >>> "AAA" in record True This essentially acts as a proxy for using "in" on the sequence: >>> "GAATTC" in record.seq False >>> "AAA" in record.seq True Note that you can also use Seq objects as the query, >>> from Bio.Seq import Seq >>> Seq("AAA") in record True See also the Seq object's __contains__ method. """ if self._seq is None: raise ValueError("Seq in SeqRecord is None, can't convert to bytes") return char in self._seq def __bytes__(self) -> bytes: if self._seq is None: raise ValueError("Seq in SeqRecord is None, can't convert to bytes") return bytes(self._seq) def __str__(self) -> str: """Return a human readable summary of the record and its annotation (string). The python built in function str works by calling the object's __str__ method. e.g. >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"), ... id="YP_025292.1", name="HokC", ... description="toxic membrane protein, small") >>> print(str(record)) ID: YP_025292.1 Name: HokC Description: toxic membrane protein, small Number of features: 0 Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF') In this example you don't actually need to call str explicitly, as the print command does this automatically: >>> print(record) ID: YP_025292.1 Name: HokC Description: toxic membrane protein, small Number of features: 0 Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF') Note that long sequences are shown truncated. """ lines: list[str] = [] if self.id: lines.append(f"ID: {self.id}") if self.name: lines.append(f"Name: {self.name}") if self.description: lines.append(f"Description: {self.description}") if self.dbxrefs: lines.append("Database cross-references: " + ", ".join(self.dbxrefs)) lines.append(f"Number of features: {len(self.features)}") for a in self.annotations: lines.append(f"/{a}={self.annotations[a]!s}") if self.letter_annotations: lines.append( "Per letter annotation for: " + ", ".join(self.letter_annotations) ) if self.seq is not None: try: bytes(self.seq) except UndefinedSequenceError: lines.append(f"Undefined sequence of length {len(self.seq)}") else: # Don't want to include the entire sequence seq = repr(self.seq) lines.append(seq) else: lines.append("Missing Sequence (None)") return "\n".join(lines) def __repr__(self) -> str: """Return a concise summary of the record for debugging (string). The python built in function repr works by calling the object's __repr__ method. e.g. >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> rec = SeqRecord(Seq("MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKAT" ... "GEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQ" ... "SGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQ" ... "PQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF"), ... id="NP_418483.1", name="b4059", ... description="ssDNA-binding protein", ... dbxrefs=["ASAP:13298", "GI:16131885", "GeneID:948570"]) >>> print(repr(rec)) SeqRecord(seq=Seq('MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTE...IPF'), id='NP_418483.1', name='b4059', description='ssDNA-binding protein', dbxrefs=['ASAP:13298', 'GI:16131885', 'GeneID:948570']) At the python prompt you can also use this shorthand: >>> rec SeqRecord(seq=Seq('MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTE...IPF'), id='NP_418483.1', name='b4059', description='ssDNA-binding protein', dbxrefs=['ASAP:13298', 'GI:16131885', 'GeneID:948570']) Note that long sequences are shown truncated. Also note that any annotations, letter_annotations and features are not shown (as they would lead to a very long string). """ return ( f"{self.__class__.__name__}(seq={self.seq!r}, id={self.id!r}," f" name={self.name!r}, description={self.description!r}," f" dbxrefs={self.dbxrefs!r})" ) def format(self, format: str) -> str: r"""Return the record as a string in the specified file format. The format should be a lower case string supported as an output format by Bio.SeqIO, which is used to turn the SeqRecord into a string. e.g. >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"), ... id="YP_025292.1", name="HokC", ... description="toxic membrane protein") >>> record.format("fasta") '>YP_025292.1 toxic membrane protein\nMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF\n' >>> print(record.format("fasta")) >YP_025292.1 toxic membrane protein MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF The Python print function automatically appends a new line, meaning in this example a blank line is shown. If you look at the string representation you can see there is a trailing new line (shown as slash n) which is important when writing to a file or if concatenating multiple sequence strings together. Note that this method will NOT work on every possible file format supported by Bio.SeqIO (e.g. some are for multiple sequences only, and binary formats are not supported). """ # See also the __format__ method return self.__format__(format) def __format__(self, format_spec: str) -> str: r"""Return the record as a string in the specified file format. This method supports the Python format() function and f-strings. The format_spec should be a lower case string supported by Bio.SeqIO as a text output file format. Requesting a binary file format raises a ValueError. e.g. >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"), ... id="YP_025292.1", name="HokC", ... description="toxic membrane protein") ... >>> format(record, "fasta") '>YP_025292.1 toxic membrane protein\nMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF\n' >>> print(f"Here is {record.id} in FASTA format:\n{record:fasta}") Here is YP_025292.1 in FASTA format: >YP_025292.1 toxic membrane protein MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF See also the SeqRecord's format() method. """ if not format_spec: # Follow python convention and default to using __str__ return str(self) from Bio import SeqIO cls = SeqIO._FormatToWriter[format_spec] try: return cls.to_string(self) # type: ignore except StreamModeError: raise ValueError( "Binary format %s cannot be used with SeqRecord format method" % format_spec ) from None def __len__(self) -> int: """Return the length of the sequence. For example, using Bio.SeqIO to read in a FASTA nucleotide file: >>> from Bio import SeqIO >>> record = SeqIO.read("Fasta/sweetpea.nu", "fasta") >>> len(record) 309 >>> len(record.seq) 309 """ return len(self._seq) if self._seq is not None else 0 def __lt__(self, other: Any) -> NoReturn: """Define the less-than operand (not implemented).""" raise NotImplementedError(_NO_SEQRECORD_COMPARISON) def __le__(self, other: Any) -> NoReturn: """Define the less-than-or-equal-to operand (not implemented).""" raise NotImplementedError(_NO_SEQRECORD_COMPARISON) def __eq__(self, other: object) -> NoReturn: """Define the equal-to operand (not implemented).""" raise NotImplementedError(_NO_SEQRECORD_COMPARISON) def __ne__(self, other: object) -> NoReturn: """Define the not-equal-to operand (not implemented).""" raise NotImplementedError(_NO_SEQRECORD_COMPARISON) def __gt__(self, other: Any) -> NoReturn: """Define the greater-than operand (not implemented).""" raise NotImplementedError(_NO_SEQRECORD_COMPARISON) def __ge__(self, other: Any) -> NoReturn: """Define the greater-than-or-equal-to operand (not implemented).""" raise NotImplementedError(_NO_SEQRECORD_COMPARISON) def __bool__(self) -> bool: """Boolean value of an instance of this class (True). This behaviour is for backwards compatibility, since until the __len__ method was added, a SeqRecord always evaluated as True. Note that in comparison, a Seq object will evaluate to False if it has a zero length sequence. WARNING: The SeqRecord may in future evaluate to False when its sequence is of zero length (in order to better match the Seq object behaviour)! """ return True def __add__( self, other: Union["SeqRecord", "Seq", "MutableSeq", str] ) -> "SeqRecord": """Add another sequence or string to this sequence. The other sequence can be a SeqRecord object, a Seq object (or similar, e.g. a MutableSeq) or a plain Python string. If you add a plain string or a Seq (like) object, the new SeqRecord will simply have this appended to the existing data. However, any per letter annotation will be lost: >>> from Bio import SeqIO >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa") >>> print("%s %s" % (record.id, record.seq)) slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN >>> print(list(record.letter_annotations)) ['solexa_quality'] >>> new = record + "ACT" >>> print("%s %s" % (new.id, new.seq)) slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNNACT >>> print(list(new.letter_annotations)) [] The new record will attempt to combine the annotation, but for any ambiguities (e.g. different names) it defaults to omitting that annotation. >>> from Bio import SeqIO >>> with open("GenBank/pBAD30.gb") as handle: ... plasmid = SeqIO.read(handle, "gb") >>> print("%s %i" % (plasmid.id, len(plasmid))) pBAD30 4923 Now let's cut the plasmid into two pieces, and join them back up the other way round (i.e. shift the starting point on this plasmid, have a look at the annotated features in the original file to see why this particular split point might make sense): >>> left = plasmid[:3765] >>> right = plasmid[3765:] >>> new = right + left >>> print("%s %i" % (new.id, len(new))) pBAD30 4923 >>> str(new.seq) == str(right.seq + left.seq) True >>> len(new.features) == len(left.features) + len(right.features) True When we add the left and right SeqRecord objects, their annotation is all consistent, so it is all conserved in the new SeqRecord: >>> new.id == left.id == right.id == plasmid.id True >>> new.name == left.name == right.name == plasmid.name True >>> new.description == plasmid.description True >>> new.annotations == left.annotations == right.annotations True >>> new.letter_annotations == plasmid.letter_annotations True >>> new.dbxrefs == left.dbxrefs == right.dbxrefs True However, we should point out that when we sliced the SeqRecord, any annotations dictionary or dbxrefs list entries were lost. You can explicitly copy them like this: >>> new.annotations = plasmid.annotations.copy() >>> new.dbxrefs = plasmid.dbxrefs[:] """ if self._seq is None: raise ValueError("Left operand seq=None, can't add") if not isinstance(other, SeqRecord): # Assume it is a string or a Seq. # Note can't transfer any per-letter-annotations return type(self)( self._seq + other, id=self.id, name=self.name, description=self.description, features=self.features[:], annotations=self.annotations.copy(), dbxrefs=self.dbxrefs[:], ) if other._seq is None: raise ValueError("Right SeqRecord has seq=None, can't add") # Adding two SeqRecord objects... must merge annotation answer = self._from_validated( self._seq + other._seq, features=self.features[:], dbxrefs=self.dbxrefs[:] ) # Will take all the features and all the db cross refs, length = len(self) for f in other.features: answer.features.append(f._shift(length)) del length for ref in other.dbxrefs: if ref not in answer.dbxrefs: answer.dbxrefs.append(ref) # Take common id/name/description/annotation if self.id == other.id: answer.id = self.id if self.name == other.name: answer.name = self.name if self.description == other.description: answer.description = self.description for k, v in self.annotations.items(): if k in other.annotations and other.annotations[k] == v: answer.annotations[k] = v # Can append matching per-letter-annotation try: # To make this type safe, we would need to make sure the types are compatible, eg: no adding tuples and str for k, v in self.letter_annotations.items(): # type: ignore if k in other.letter_annotations: # avoid length checks, but otherwise equivalent to answer.letter_annotations[k] = v + other.letter_annotations[k] dict.__setitem__(answer.letter_annotations, k, v + other.letter_annotations[k]) # type: ignore except TypeError: print("Failed while try to concatenate letter annotations") raise return answer def __radd__(self, other: Union["Seq", "MutableSeq", str]) -> "SeqRecord": """Add another sequence or string to this sequence (from the left). This method handles adding a Seq object (or similar, e.g. MutableSeq) or a plain Python string (on the left) to a SeqRecord (on the right). See the __add__ method for more details, but for example: >>> from Bio import SeqIO >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa") >>> print("%s %s" % (record.id, record.seq)) slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN >>> print(list(record.letter_annotations)) ['solexa_quality'] >>> new = "ACT" + record >>> print("%s %s" % (new.id, new.seq)) slxa_0001_1_0001_01 ACTACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN >>> print(list(new.letter_annotations)) [] """ if isinstance(other, SeqRecord): raise RuntimeError( "This should have happened via the __add__ of " "the other SeqRecord being added!" ) if self.seq is None: raise TypeError("Can't add (right hand side) SeqRecord with seq = None") # Assume it is a string or a Seq. # Note can't transfer any per-letter-annotations offset = len(other) return type(self)( cast(Union[Seq, MutableSeq], other + self.seq), id=self.id, name=self.name, description=self.description, features=[f._shift(offset) for f in self.features], annotations=self.annotations.copy(), dbxrefs=self.dbxrefs[:], ) def count(self, sub, start=None, end=None): """Return the number of non-overlapping occurrences of sub in seq[start:end]. Optional arguments start and end are interpreted as in slice notation. This method behaves as the count method of Python strings. """ if self._seq is None: raise ValueError( "seq is SeqRecord is None, assign it a sequence before applying count" ) return self.seq.count(sub, start, end) def upper(self) -> "SeqRecord": """Return a copy of the record with an upper case sequence. All the annotation is preserved unchanged. e.g. >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> record = SeqRecord(Seq("acgtACGT"), id="Test", ... description = "Made up for this example") >>> record.letter_annotations["phred_quality"] = [1, 2, 3, 4, 5, 6, 7, 8] >>> print(record.upper().format("fastq")) @Test Made up for this example ACGTACGT + "#$%&'() Naturally, there is a matching lower method: >>> print(record.lower().format("fastq")) @Test Made up for this example acgtacgt + "#$%&'() """ if self.seq is None: raise ValueError( "seq is SeqRecord is None, assign it a sequence before applying upper" ) return self._from_validated( self.seq.upper(), id=self.id, name=self.name, description=self.description, dbxrefs=self.dbxrefs[:], features=self.features[:], annotations=self.annotations.copy(), letter_annotations=( None if self._per_letter_annotations is None else self.letter_annotations.copy() ), ) def lower(self) -> "SeqRecord": """Return a copy of the record with a lower case sequence. All the annotation is preserved unchanged. e.g. >>> from Bio import SeqIO >>> record = SeqIO.read("Fasta/aster.pro", "fasta") >>> print(record.format("fasta")) >gi|3298468|dbj|BAA31520.1| SAMIPF GGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSTVACLLLKFVTNDMAVGVFSLSAGVG VTNALVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANI >>> print(record.lower().format("fasta")) >gi|3298468|dbj|BAA31520.1| SAMIPF gghvnpavtfgafvggnitllrgivyiiaqllgstvaclllkfvtndmavgvfslsagvg vtnalvfeivmtfglvytvyataidpkkgslgtiapiaigfivgani To take a more annotation rich example, >>> from Bio import SeqIO >>> old = SeqIO.read("EMBL/TRBG361.embl", "embl") >>> len(old.features) 3 >>> new = old.lower() >>> len(old.features) == len(new.features) True >>> old.annotations["organism"] == new.annotations["organism"] True >>> old.dbxrefs == new.dbxrefs True """ if self.seq is None: raise ValueError( "seq is SeqRecord is None, assign it a sequence before applying lower" ) return self._from_validated( self.seq.lower(), id=self.id, name=self.name, description=self.description, dbxrefs=self.dbxrefs[:], features=self.features[:], annotations=self.annotations.copy(), letter_annotations=( None if self._per_letter_annotations is None else self.letter_annotations.copy() ), ) def isupper(self): """Return True if all ASCII characters in the record's sequence are uppercase. If there are no cased characters, the method returns False. """ return self.seq.isupper() def islower(self): """Return True if all ASCII characters in the record's sequence are lowercase. If there are no cased characters, the method returns False. """ return self.seq.islower() def reverse_complement( self, id: bool = False, name: bool = False, description: bool = False, features: bool = True, annotations: bool = False, letter_annotations: bool = True, dbxrefs: bool = False, ) -> "SeqRecord": """Return new SeqRecord with reverse complement sequence. By default the new record does NOT preserve the sequence identifier, name, description, general annotation or database cross-references - these are unlikely to apply to the reversed sequence. You can specify the returned record's id, name and description as strings, or True to keep that of the parent, or False for a default. You can specify the returned record's features with a list of SeqFeature objects, or True to keep that of the parent, or False to omit them. The default is to keep the original features (with the strand and locations adjusted). You can also specify both the returned record's annotations and letter_annotations as dictionaries, True to keep that of the parent, or False to omit them. The default is to keep the original annotations (with the letter annotations reversed). To show what happens to the pre-letter annotations, consider an example Solexa variant FASTQ file with a single entry, which we'll read in as a SeqRecord: >>> from Bio import SeqIO >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa") >>> print("%s %s" % (record.id, record.seq)) slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN >>> print(list(record.letter_annotations)) ['solexa_quality'] >>> print(record.letter_annotations["solexa_quality"]) [40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0, -1, -2, -3, -4, -5] Now take the reverse complement, here we explicitly give a new identifier (the old identifier with a suffix): >>> rc_record = record.reverse_complement(id=record.id + "_rc") >>> print("%s %s" % (rc_record.id, rc_record.seq)) slxa_0001_1_0001_01_rc NNNNNNACGTACGTACGTACGTACGTACGTACGTACGTACGTACGT Notice that the per-letter-annotations have also been reversed, although this may not be appropriate for all cases. >>> print(rc_record.letter_annotations["solexa_quality"]) [-5, -4, -3, -2, -1, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40] Now for the features, we need a different example. Parsing a GenBank file is probably the easiest way to get an nice example with features in it... >>> from Bio import SeqIO >>> with open("GenBank/pBAD30.gb") as handle: ... plasmid = SeqIO.read(handle, "gb") >>> print("%s %i" % (plasmid.id, len(plasmid))) pBAD30 4923 >>> plasmid.seq Seq('GCTAGCGGAGTGTATACTGGCTTACTATGTTGGCACTGATGAGGGTGTCAGTGA...ATG') >>> len(plasmid.features) 13 Now, let's take the reverse complement of this whole plasmid: >>> rc_plasmid = plasmid.reverse_complement(id=plasmid.id+"_rc") >>> print("%s %i" % (rc_plasmid.id, len(rc_plasmid))) pBAD30_rc 4923 >>> rc_plasmid.seq Seq('CATGGGCAAATATTATACGCAAGGCGACAAGGTGCTGATGCCGCTGGCGATTCA...AGC') >>> len(rc_plasmid.features) 13 Let's compare the first CDS feature - it has gone from being the second feature (index 1) to the second last feature (index -2), its strand has changed, and the location switched round. >>> print(plasmid.features[1]) type: CDS location: [1081:1960](-) qualifiers: Key: label, Value: ['araC'] Key: note, Value: ['araC regulator of the arabinose BAD promoter'] Key: vntifkey, Value: ['4'] >>> print(rc_plasmid.features[-2]) type: CDS location: [2963:3842](+) qualifiers: Key: label, Value: ['araC'] Key: note, Value: ['araC regulator of the arabinose BAD promoter'] Key: vntifkey, Value: ['4'] You can check this new location, based on the length of the plasmid: >>> len(plasmid) - 1081 3842 >>> len(plasmid) - 1960 2963 Note that if the SeqFeature annotation includes any strand specific information (e.g. base changes for a SNP), this information is not amended, and would need correction after the reverse complement. Note trying to reverse complement a protein SeqRecord raises an exception: >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> protein_rec = SeqRecord(Seq("MAIVMGR"), id="Test", ... annotations={"molecule_type": "protein"}) >>> protein_rec.reverse_complement() Traceback (most recent call last): ... ValueError: Proteins do not have complements! If you have RNA without any U bases, it must be annotated as RNA otherwise it will be treated as DNA by default with A mapped to T: >>> from Bio.Seq import Seq >>> from Bio.SeqRecord import SeqRecord >>> rna1 = SeqRecord(Seq("ACG"), id="Test") >>> rna2 = SeqRecord(Seq("ACG"), id="Test", annotations={"molecule_type": "RNA"}) >>> print(rna1.reverse_complement(id="RC", description="unk").format("fasta")) >RC unk CGT >>> print(rna2.reverse_complement(id="RC", description="RNA").format("fasta")) >RC RNA CGU Also note you can reverse complement a SeqRecord using a MutableSeq: >>> from Bio.Seq import MutableSeq >>> from Bio.SeqRecord import SeqRecord >>> rec = SeqRecord(MutableSeq("ACGT"), id="Test") >>> rec.seq[0] = "T" >>> print("%s %s" % (rec.id, rec.seq)) Test TCGT >>> rc = rec.reverse_complement(id=True) >>> print("%s %s" % (rc.id, rc.seq)) Test ACGA """ if self.seq is None: raise ValueError( "Seq in SeqRecord is None, so can't construct the reverse_complement. Please assign it a sequence first" ) if "protein" in cast(str, self.annotations.get("molecule_type", "")): raise ValueError("Proteins do not have complements!") if "RNA" in cast(str, self.annotations.get("molecule_type", "")): seq = self.seq.reverse_complement_rna() else: # Default to DNA seq = self.seq.reverse_complement() if isinstance(self.seq, MutableSeq): seq = Seq(seq) answer = self._from_validated(seq) if isinstance(id, str): answer.id = id elif id: answer.id = self.id if isinstance(name, str): answer.name = name elif name: answer.name = self.name if isinstance(description, str): answer.description = description elif description: answer.description = self.description if isinstance(dbxrefs, list): answer.dbxrefs = dbxrefs elif dbxrefs: # Copy the old dbxrefs answer.dbxrefs = self.dbxrefs[:] if isinstance(features, list): answer.features = features elif features: # Copy the old features, adjusting location and string length = len(answer) answer.features = [f._flip(length) for f in self.features] # The old list should have been sorted by start location, # reversing it will leave it sorted by what is now the end position, # so we need to resort in case of overlapping features. # NOTE - In the common case of gene before CDS (and similar) with # the exact same locations, this will still maintain gene before CDS def key_fun(f): """Sort on start position.""" try: return int(f.location.start) except TypeError: # Expected for UnknownPosition return None answer.features.sort(key=key_fun) if isinstance(annotations, dict): answer.annotations = annotations elif annotations: # Copy the old annotations, answer.annotations = self.annotations.copy() if self._per_letter_annotations is not None: if isinstance(letter_annotations, dict): answer.letter_annotations = letter_annotations elif letter_annotations: # Copy the old per letter annotations, reversing them for key, value in self.letter_annotations.items(): answer.letter_annotations[key] = value[::-1] return answer def translate( self, # Seq translation arguments: table: str = "Standard", stop_symbol: str = "*", to_stop: bool = False, cds: bool = False, gap: str | None = None, # SeqRecord annotation arguments: id: bool = False, name: bool = False, description: bool = False, features: bool = False, annotations: bool = False, letter_annotations: bool = False, dbxrefs: bool = False, ) -> "SeqRecord": """Return new SeqRecord with translated sequence. This calls the record's .seq.translate() method (which describes the translation related arguments, like table for the genetic code), By default the new record does NOT preserve the sequence identifier, name, description, general annotation or database cross-references - these are unlikely to apply to the translated sequence. You can specify the returned record's id, name and description as strings, or True to keep that of the parent, or False for a default. You can specify the returned record's features with a list of SeqFeature objects, or False (default) to omit them. You can also specify both the returned record's annotations and letter_annotations as dictionaries, True to keep that of the parent (annotations only), or False (default) to omit them. e.g. Loading a FASTA gene and translating it, >>> from Bio import SeqIO >>> gene_record = SeqIO.read("Fasta/sweetpea.nu", "fasta") >>> print(gene_record.format("fasta")) >gi|3176602|gb|U78617.1|LOU78617 Lathyrus odoratus phytochrome A (PHYA) gene, partial cds CAGGCTGCGCGGTTTCTATTTATGAAGAACAAGGTCCGTATGATAGTTGATTGTCATGCA AAACATGTGAAGGTTCTTCAAGACGAAAAACTCCCATTTGATTTGACTCTGTGCGGTTCG ACCTTAAGAGCTCCACATAGTTGCCATTTGCAGTACATGGCTAACATGGATTCAATTGCT TCATTGGTTATGGCAGTGGTCGTCAATGACAGCGATGAAGATGGAGATAGCCGTGACGCA GTTCTACCACAAAAGAAAAAGAGACTTTGGGGTTTGGTAGTTTGTCATAACACTACTCCG AGGTTTGTT And now translating the record, specifying the new ID and description: >>> protein_record = gene_record.translate(table=11, ... id="phya", ... description="translation") >>> print(protein_record.format("fasta")) >phya translation QAARFLFMKNKVRMIVDCHAKHVKVLQDEKLPFDLTLCGSTLRAPHSCHLQYMANMDSIA SLVMAVVVNDSDEDGDSRDAVLPQKKKRLWGLVVCHNTTPRFV """ if "protein" == self.annotations.get("molecule_type", ""): raise ValueError("Proteins cannot be translated!") if self.seq is None: raise ValueError("Seq in SeqRecord is None, can't be translated") answer = SeqRecord( self.seq.translate( table=table, stop_symbol=stop_symbol, to_stop=to_stop, cds=cds, gap=gap ) ) if isinstance(id, str): answer.id = id elif id: answer.id = self.id if isinstance(name, str): answer.name = name elif name: answer.name = self.name if isinstance(description, str): answer.description = description elif description: answer.description = self.description if isinstance(dbxrefs, list): answer.dbxrefs = dbxrefs elif dbxrefs: # Copy the old dbxrefs answer.dbxrefs = self.dbxrefs[:] if isinstance(features, list): answer.features = features elif features: # Does not make sense to copy old features as locations wrong raise TypeError(f"Unexpected features argument {features!r}") if isinstance(annotations, dict): answer.annotations = annotations elif annotations: # Copy the old annotations answer.annotations = self.annotations.copy() # Set/update to protein: answer.annotations["molecule_type"] = "protein" if self._per_letter_annotations is not None: if isinstance(letter_annotations, dict): answer.letter_annotations = letter_annotations elif letter_annotations: # Does not make sense to copy these as length now wrong raise TypeError( f"Unexpected letter_annotations argument {letter_annotations!r}" ) return answer if __name__ == "__main__": from Bio._utils import run_doctest run_doctest()