mirror of
https://github.com/biopython/biopython.git
synced 2025-10-20 21:53:47 +08:00
Refactor SearchIO indexing tests
This commit is contained in:
@ -1,12 +1,82 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# Revisions Copyright 2012 by Peter Cock. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
from Bio.SearchIO import HSPFragment
|
||||
import os
|
||||
import unittest
|
||||
try:
|
||||
import sqlite3
|
||||
except ImportError:
|
||||
sqlite3 = None
|
||||
|
||||
from Bio import SearchIO
|
||||
from Bio._py3k import _as_bytes
|
||||
from Bio.SeqRecord import SeqRecord
|
||||
|
||||
|
||||
class CheckRaw(unittest.TestCase):
|
||||
|
||||
"""Base class for testing index's get_raw method."""
|
||||
|
||||
def check_raw(self, filename, id, raw, **kwargs):
|
||||
"""Index filename using **kwargs, check get_raw(id)==raw."""
|
||||
idx = SearchIO.index(filename, self.fmt, **kwargs)
|
||||
raw = _as_bytes(raw)
|
||||
self.assertEqual(raw, idx.get_raw(id))
|
||||
idx._proxy._handle.close() # To silence a ResourceWarning
|
||||
|
||||
#Now again, but using SQLite backend
|
||||
if sqlite3:
|
||||
idx = SearchIO.index_db(":memory:", filename, self.fmt, **kwargs)
|
||||
self.assertEqual(raw, idx.get_raw(id))
|
||||
idx.close()
|
||||
|
||||
if os.path.isfile(filename + ".bgz"):
|
||||
#Do the tests again with the BGZF compressed file
|
||||
print "[BONUS %s.bgz]" % filename
|
||||
self.check_raw(filename + ".bgz", id, raw, **kwargs)
|
||||
|
||||
|
||||
class CheckIndex(unittest.TestCase):
|
||||
|
||||
"""Base class for testing indexing."""
|
||||
|
||||
def check_index(self, filename, format, **kwargs):
|
||||
# check if Python3 installation has sqlite3
|
||||
try:
|
||||
import sqlite3
|
||||
except ImportError:
|
||||
sqlite3 = None
|
||||
|
||||
parsed = list(SearchIO.parse(filename, format, **kwargs))
|
||||
# compare values by index
|
||||
indexed = SearchIO.index(filename, format, **kwargs)
|
||||
self.assertEqual(len(parsed), len(indexed.keys()))
|
||||
# compare values by index_db, only if sqlite3 is present
|
||||
if sqlite3 is not None:
|
||||
db_indexed = SearchIO.index_db(':memory:', [filename], format, **kwargs)
|
||||
self.assertEqual(len(parsed), len(db_indexed.keys()))
|
||||
|
||||
for qres in parsed:
|
||||
idx_qres = indexed[qres.id]
|
||||
# parsed and indexed qresult are different objects!
|
||||
self.assertNotEqual(id(qres), id(idx_qres))
|
||||
# but they should have the same attribute values
|
||||
self.assertTrue(compare_search_obj(qres, idx_qres))
|
||||
# sqlite3 comparison, only if it's present
|
||||
if sqlite3 is not None:
|
||||
dbidx_qres = db_indexed[qres.id]
|
||||
self.assertNotEqual(id(qres), id(dbidx_qres))
|
||||
self.assertTrue(compare_search_obj(qres, dbidx_qres))
|
||||
|
||||
indexed._proxy._handle.close() # TODO - Better solution
|
||||
if sqlite3 is not None:
|
||||
db_indexed.close()
|
||||
db_indexed._con.close()
|
||||
|
||||
|
||||
def _num_difference(obj_a, obj_b):
|
||||
"""Returns the number of instance attributes presence only in one object."""
|
||||
attrs_a = obj_a.__dict__.keys()
|
||||
@ -27,7 +97,7 @@ def compare_search_obj(obj_a, obj_b):
|
||||
compare_attrs(obj_a, obj_b, obj_a.__dict__.keys())
|
||||
|
||||
# compare objects recursively if it's not an HSPFragment
|
||||
if not isinstance(obj_a, HSPFragment):
|
||||
if not isinstance(obj_a, SearchIO.HSPFragment):
|
||||
# check the number of hits contained
|
||||
assert len(obj_a) == len(obj_b), "length: %r vs %r" % (len(obj_a),
|
||||
len(obj_b), obj_a, obj_b)
|
||||
|
174
Tests/test_SearchIO_blast_tab_index.py
Normal file
174
Tests/test_SearchIO_blast_tab_index.py
Normal file
@ -0,0 +1,174 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO blast-tab indexing."""
|
||||
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckRaw, CheckIndex
|
||||
|
||||
|
||||
class BlastTabRawCases(CheckRaw):
|
||||
"""Check BLAST tabular get_raw method."""
|
||||
|
||||
fmt = 'blast-tab'
|
||||
|
||||
def test_blasttab_2226_multiple_first(self):
|
||||
"""Test blast-tab raw string retrieval, BLAST 2.2.26+, multiple queries, first (tab_2226_tblastn_001.txt)"""
|
||||
filename = 'Blast/tab_2226_tblastn_001.txt'
|
||||
raw = """gi|16080617|ref|NP_391444.1| gi|145479850|ref|XM_001425911.1| 34.88 43 28 0 31 73 1744 1872 1e-05 34.7
|
||||
gi|16080617|ref|NP_391444.1| gi|72012412|ref|XM_777959.1| 33.90 59 31 1 44 94 1057 1233 1e-04 31.6
|
||||
gi|16080617|ref|NP_391444.1| gi|115975252|ref|XM_001180111.1| 33.90 59 31 1 44 94 1057 1233 1e-04 31.6
|
||||
"""
|
||||
self.check_raw(filename, "gi|16080617|ref|NP_391444.1|", raw)
|
||||
|
||||
def test_blasttab_2226_multiple_last(self):
|
||||
"""Test blast-tab raw string retrieval, BLAST 2.2.26+, multiple queries, last (tab_2226_tblastn_001.txt)"""
|
||||
filename = 'Blast/tab_2226_tblastn_001.txt'
|
||||
raw = """gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 95.92 98 4 0 1 98 95 388 2e-67 199
|
||||
gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 29.58 71 46 2 30 96 542 754 4e-05 32.7
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 97.96 98 2 0 1 98 78 371 2e-67 202
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 30.00 100 64 2 3 96 804 1103 3e-09 45.1
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 97.96 98 2 0 1 98 161 454 4e-67 202
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 30.00 100 64 2 3 96 866 1165 3e-09 45.1
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 97.96 98 2 0 1 98 173 466 2e-66 202
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 31.00 100 63 2 3 96 899 1198 1e-09 46.6
|
||||
gi|11464971:4-101 gi|365982352|ref|XM_003667962.1| 30.77 52 27 1 12 54 3181 3336 1.7 19.6
|
||||
"""
|
||||
self.check_raw(filename, "gi|11464971:4-101", raw)
|
||||
|
||||
def test_blasttab_2226_single(self):
|
||||
"""Test blast-tab raw string retrieval, BLAST 2.2.26+, single query (tab_2226_tblastn_004.txt)"""
|
||||
filename = 'Blast/tab_2226_tblastn_004.txt'
|
||||
raw = """gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 95.92 98 4 0 1 98 95 388 2e-67 199
|
||||
gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 29.58 71 46 2 30 96 542 754 4e-05 32.7
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 97.96 98 2 0 1 98 78 371 2e-67 202
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 30.00 100 64 2 3 96 804 1103 3e-09 45.1
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 97.96 98 2 0 1 98 161 454 4e-67 202
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 30.00 100 64 2 3 96 866 1165 3e-09 45.1
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 97.96 98 2 0 1 98 173 466 2e-66 202
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 31.00 100 63 2 3 96 899 1198 1e-09 46.6
|
||||
gi|11464971:4-101 gi|365982352|ref|XM_003667962.1| 30.77 52 27 1 12 54 3181 3336 1.7 19.6
|
||||
"""
|
||||
self.check_raw(filename, "gi|11464971:4-101", raw)
|
||||
|
||||
def test_blasttab_2226_multiple_first_commented(self):
|
||||
"""Test blast-tab raw string retrieval, BLAST 2.2.26+, multiple queries, first, commented (tab_2226_tblastn_005.txt)"""
|
||||
filename = 'Blast/tab_2226_tblastn_005.txt'
|
||||
raw = """# TBLASTN 2.2.26+
|
||||
# Query: random_s00
|
||||
# Database: db/minirefseq_mrna
|
||||
# 0 hits found
|
||||
"""
|
||||
self.check_raw(filename, "random_s00", raw, comments=True)
|
||||
|
||||
def test_blasttab_2226_multiple_middle_commented(self):
|
||||
"""Test blast-tab raw string retrieval, BLAST 2.2.26+, multiple queries, middle, commented (tab_2226_tblastn_005.txt)"""
|
||||
filename = 'Blast/tab_2226_tblastn_005.txt'
|
||||
raw = """# TBLASTN 2.2.26+
|
||||
# Query: gi|16080617|ref|NP_391444.1| membrane bound lipoprotein [Bacillus subtilis subsp. subtilis str. 168]
|
||||
# Database: db/minirefseq_mrna
|
||||
# Fields: query id, subject id, % identity, alignment length, mismatches, gap opens, q. start, q. end, s. start, s. end, evalue, bit score
|
||||
# 3 hits found
|
||||
gi|16080617|ref|NP_391444.1| gi|145479850|ref|XM_001425911.1| 34.88 43 28 0 31 73 1744 1872 1e-05 34.7
|
||||
gi|16080617|ref|NP_391444.1| gi|72012412|ref|XM_777959.1| 33.90 59 31 1 44 94 1057 1233 1e-04 31.6
|
||||
gi|16080617|ref|NP_391444.1| gi|115975252|ref|XM_001180111.1| 33.90 59 31 1 44 94 1057 1233 1e-04 31.6
|
||||
"""
|
||||
self.check_raw(filename, "gi|16080617|ref|NP_391444.1|", raw, comments=True)
|
||||
|
||||
def test_blasttab_2226_multiple_last_commented(self):
|
||||
"""Test blast-tab raw string retrieval, BLAST 2.2.26+, multiple queries, last, commented (tab_2226_tblastn_005.txt)"""
|
||||
filename = 'Blast/tab_2226_tblastn_005.txt'
|
||||
raw = """# TBLASTN 2.2.26+
|
||||
# Query: gi|11464971:4-101 pleckstrin [Mus musculus]
|
||||
# Database: db/minirefseq_mrna
|
||||
# Fields: query id, subject id, % identity, alignment length, mismatches, gap opens, q. start, q. end, s. start, s. end, evalue, bit score
|
||||
# 9 hits found
|
||||
gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 95.92 98 4 0 1 98 95 388 2e-67 199
|
||||
gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 29.58 71 46 2 30 96 542 754 4e-05 32.7
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 97.96 98 2 0 1 98 78 371 2e-67 202
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 30.00 100 64 2 3 96 804 1103 3e-09 45.1
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 97.96 98 2 0 1 98 161 454 4e-67 202
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 30.00 100 64 2 3 96 866 1165 3e-09 45.1
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 97.96 98 2 0 1 98 173 466 2e-66 202
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 31.00 100 63 2 3 96 899 1198 1e-09 46.6
|
||||
gi|11464971:4-101 gi|365982352|ref|XM_003667962.1| 30.77 52 27 1 12 54 3181 3336 1.7 19.6
|
||||
"""
|
||||
self.check_raw(filename, "gi|11464971:4-101", raw, comments=True)
|
||||
|
||||
def test_blasttab_2226_single_commented(self):
|
||||
"""Test blast-tab raw string retrieval, BLAST 2.2.26+, single query, commented (tab_2226_tblastn_008.txt)"""
|
||||
filename = 'Blast/tab_2226_tblastn_008.txt'
|
||||
raw = """# TBLASTN 2.2.26+
|
||||
# Query: gi|11464971:4-101 pleckstrin [Mus musculus]
|
||||
# Database: db/minirefseq_mrna
|
||||
# Fields: query id, subject id, % identity, alignment length, mismatches, gap opens, q. start, q. end, s. start, s. end, evalue, bit score
|
||||
# 9 hits found
|
||||
gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 95.92 98 4 0 1 98 95 388 2e-67 199
|
||||
gi|11464971:4-101 gi|350596019|ref|XM_003360601.2| 29.58 71 46 2 30 96 542 754 4e-05 32.7
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 97.96 98 2 0 1 98 78 371 2e-67 202
|
||||
gi|11464971:4-101 gi|301779869|ref|XM_002925302.1| 30.00 100 64 2 3 96 804 1103 3e-09 45.1
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 97.96 98 2 0 1 98 161 454 4e-67 202
|
||||
gi|11464971:4-101 gi|296223671|ref|XM_002757683.1| 30.00 100 64 2 3 96 866 1165 3e-09 45.1
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 97.96 98 2 0 1 98 173 466 2e-66 202
|
||||
gi|11464971:4-101 gi|338714227|ref|XM_001492113.3| 31.00 100 63 2 3 96 899 1198 1e-09 46.6
|
||||
gi|11464971:4-101 gi|365982352|ref|XM_003667962.1| 30.77 52 27 1 12 54 3181 3336 1.7 19.6
|
||||
"""
|
||||
self.check_raw(filename, "gi|11464971:4-101", raw, comments=True)
|
||||
|
||||
|
||||
class BlastTabIndexCases(CheckIndex):
|
||||
|
||||
fmt = 'blast-tab'
|
||||
|
||||
def test_blasttab_2226_tblastn_001(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, multiple queries"""
|
||||
filename = 'Blast/tab_2226_tblastn_001.txt'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blasttab_2226_tblastn_002(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, single query, no hits"""
|
||||
filename = 'Blast/tab_2226_tblastn_002.txt'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blasttab_2226_tblastn_004(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, single query, multiple hits"""
|
||||
filename = 'Blast/tab_2226_tblastn_004.txt'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blasttab_2226_tblastn_005(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, multiple queries, commented"""
|
||||
filename = 'Blast/tab_2226_tblastn_005.txt'
|
||||
self.check_index(filename, self.fmt, comments=True)
|
||||
|
||||
def test_blasttab_2226_tblastn_006(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, single query, no hits, commented"""
|
||||
filename = 'Blast/tab_2226_tblastn_006.txt'
|
||||
self.check_index(filename, self.fmt, comments=True)
|
||||
|
||||
def test_blasttab_comment_sing(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, single query, multiple hits, commented"""
|
||||
filename = 'Blast/tab_2226_tblastn_008.txt'
|
||||
self.check_index(filename, self.fmt, comments=True)
|
||||
|
||||
def test_blasttab_2226_tblastn_009(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, custom columns"""
|
||||
filename = 'Blast/tab_2226_tblastn_009.txt'
|
||||
self.check_index(filename, self.fmt, fields=['qseqid', 'sseqid'])
|
||||
|
||||
def test_blasttab_2226_tblastn_010(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, custom columns, commented"""
|
||||
filename = 'Blast/tab_2226_tblastn_010.txt'
|
||||
self.check_index(filename, self.fmt, comments=True)
|
||||
|
||||
def test_blasttab_2226_tblastn_011(self):
|
||||
"""Test blast-tab indexing, BLAST 2.2.26+, all columns, commented"""
|
||||
filename = 'Blast/tab_2226_tblastn_011.txt'
|
||||
self.check_index(filename, self.fmt, comments=True)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
767
Tests/test_SearchIO_blast_xml_index.py
Normal file
767
Tests/test_SearchIO_blast_xml_index.py
Normal file
@ -0,0 +1,767 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO blast-xml indexing."""
|
||||
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckRaw, CheckIndex
|
||||
|
||||
|
||||
class BlastXmlRawCases(CheckRaw):
|
||||
|
||||
"""Check BLAST XML get_raw method."""
|
||||
|
||||
fmt = 'blast-xml'
|
||||
|
||||
def test_blastxml_2226_multiple_first(self):
|
||||
"""Test blast-xml raw string retrieval, BLAST 2.2.26+, multiple queries, first (xml_2226_blastp_001.xml)"""
|
||||
filename = 'Blast/xml_2226_blastp_001.xml'
|
||||
raw = """ <Iteration>
|
||||
<Iteration_iter-num>1</Iteration_iter-num>
|
||||
<Iteration_query-ID>Query_1</Iteration_query-ID>
|
||||
<Iteration_query-def>random_s00</Iteration_query-def>
|
||||
<Iteration_query-len>32</Iteration_query-len>
|
||||
<Iteration_hits></Iteration_hits>
|
||||
<Iteration_stat>
|
||||
<Statistics>
|
||||
<Statistics_db-num>20</Statistics_db-num>
|
||||
<Statistics_db-len>6406</Statistics_db-len>
|
||||
<Statistics_hsp-len>7</Statistics_hsp-len>
|
||||
<Statistics_eff-space>156650</Statistics_eff-space>
|
||||
<Statistics_kappa>0.041</Statistics_kappa>
|
||||
<Statistics_lambda>0.267</Statistics_lambda>
|
||||
<Statistics_entropy>0.14</Statistics_entropy>
|
||||
</Statistics>
|
||||
</Iteration_stat>
|
||||
<Iteration_message>No hits found</Iteration_message>
|
||||
</Iteration>
|
||||
"""
|
||||
self.check_raw(filename, "random_s00", raw)
|
||||
|
||||
def test_blastxml_2226_multiple_middle(self):
|
||||
"""Test blast-xml raw string retrieval, BLAST 2.2.26+, multiple queries, middle (xml_2226_blastp_001.xml)"""
|
||||
filename = 'Blast/xml_2226_blastp_001.xml'
|
||||
raw = """ <Iteration>
|
||||
<Iteration_iter-num>2</Iteration_iter-num>
|
||||
<Iteration_query-ID>Query_2</Iteration_query-ID>
|
||||
<Iteration_query-def>gi|16080617|ref|NP_391444.1| membrane bound lipoprotein [Bacillus subtilis subsp. subtilis str. 168]</Iteration_query-def>
|
||||
<Iteration_query-len>102</Iteration_query-len>
|
||||
<Iteration_hits>
|
||||
<Hit>
|
||||
<Hit_num>1</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|1</Hit_id>
|
||||
<Hit_def>gi|308175296|ref|YP_003922001.1| membrane bound lipoprotein [Bacillus amyloliquefaciens DSM 7]</Hit_def>
|
||||
<Hit_accession>1</Hit_accession>
|
||||
<Hit_len>100</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>139.428</Hsp_bit-score>
|
||||
<Hsp_score>350</Hsp_score>
|
||||
<Hsp_evalue>1.99275e-46</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>102</Hsp_query-to>
|
||||
<Hsp_hit-from>1</Hsp_hit-from>
|
||||
<Hsp_hit-to>100</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>69</Hsp_identity>
|
||||
<Hsp_positive>81</Hsp_positive>
|
||||
<Hsp_gaps>2</Hsp_gaps>
|
||||
<Hsp_align-len>102</Hsp_align-len>
|
||||
<Hsp_qseq>MKKFIALLFFILLLSGCGVNSQKSQGEDVSPDSNIETKEGTYVGLADTHTIEVTVDNEPVSLDITEESTSDLDKFNSGDKVTITYEKNDEGQLLLKDIERAN</Hsp_qseq>
|
||||
<Hsp_hseq>MKKIFGCLFFILLLAGCGVTNEKSQGEDAG--EKLVTKEGTYVGLADTHTIEVTVDHEPVSFDITEESADDVKNLNNGEKVTVKYQKNSKGQLVLKDIEPAN</Hsp_hseq>
|
||||
<Hsp_midline>MKK LFFILLL+GCGV ++KSQGED + TKEGTYVGLADTHTIEVTVD+EPVS DITEES D+ N+G+KVT+ Y+KN +GQL+LKDIE AN</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>2</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|2</Hit_id>
|
||||
<Hit_def>gi|375363999|ref|YP_005132038.1| lytA gene product [Bacillus amyloliquefaciens subsp. plantarum CAU B946]</Hit_def>
|
||||
<Hit_accession>2</Hit_accession>
|
||||
<Hit_len>105</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>88.9669</Hsp_bit-score>
|
||||
<Hsp_score>219</Hsp_score>
|
||||
<Hsp_evalue>6.94052e-27</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>101</Hsp_query-to>
|
||||
<Hsp_hit-from>1</Hsp_hit-from>
|
||||
<Hsp_hit-to>104</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>48</Hsp_identity>
|
||||
<Hsp_positive>69</Hsp_positive>
|
||||
<Hsp_gaps>5</Hsp_gaps>
|
||||
<Hsp_align-len>105</Hsp_align-len>
|
||||
<Hsp_qseq>MKKFIALLFFILL----LSGCGVNSQKSQGEDVSPDSNIETKEGTYVGLADTHTIEVTVDNEPVSLDITEESTSDLDKFNSGDKVTITYEKNDEGQLLLKDIERA</Hsp_qseq>
|
||||
<Hsp_hseq>MKKTIAASFLILLFSVVLAACGTAEQSKKGSG-SSENQAQKETAYYVGMADTHTIEVKVDDQPVSFEFSDDFSDVLNKFSENDKVSITYFTNDKGQKEIKEIEKA</Hsp_hseq>
|
||||
<Hsp_midline>MKK IA F ILL L+ CG Q +G S ++ + + YVG+ADTHTIEV VD++PVS + +++ + L+KF+ DKV+ITY ND+GQ +K+IE+A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>3</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|3</Hit_id>
|
||||
<Hit_def>gi|154687679|ref|YP_001422840.1| LytA [Bacillus amyloliquefaciens FZB42]</Hit_def>
|
||||
<Hit_accession>3</Hit_accession>
|
||||
<Hit_len>105</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>88.9669</Hsp_bit-score>
|
||||
<Hsp_score>219</Hsp_score>
|
||||
<Hsp_evalue>8.41012e-27</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>101</Hsp_query-to>
|
||||
<Hsp_hit-from>1</Hsp_hit-from>
|
||||
<Hsp_hit-to>104</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>48</Hsp_identity>
|
||||
<Hsp_positive>69</Hsp_positive>
|
||||
<Hsp_gaps>5</Hsp_gaps>
|
||||
<Hsp_align-len>105</Hsp_align-len>
|
||||
<Hsp_qseq>MKKFIALLFFILL----LSGCGVNSQKSQGEDVSPDSNIETKEGTYVGLADTHTIEVTVDNEPVSLDITEESTSDLDKFNSGDKVTITYEKNDEGQLLLKDIERA</Hsp_qseq>
|
||||
<Hsp_hseq>MKKTIAASFLILLFSVVLAACGTADQSKKGSG-SSENQAQKETAYYVGMADTHTIEVKVDDQPVSFEFSDDFSDVLNKFSENDKVSITYFTNDKGQKEIKEIEKA</Hsp_hseq>
|
||||
<Hsp_midline>MKK IA F ILL L+ CG Q +G S ++ + + YVG+ADTHTIEV VD++PVS + +++ + L+KF+ DKV+ITY ND+GQ +K+IE+A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>4</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|4</Hit_id>
|
||||
<Hit_def>gi|311070071|ref|YP_003974994.1| unnamed protein product [Bacillus atrophaeus 1942]</Hit_def>
|
||||
<Hit_accession>4</Hit_accession>
|
||||
<Hit_len>105</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>83.1889</Hsp_bit-score>
|
||||
<Hsp_score>204</Hsp_score>
|
||||
<Hsp_evalue>1.37847e-24</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>100</Hsp_query-to>
|
||||
<Hsp_hit-from>1</Hsp_hit-from>
|
||||
<Hsp_hit-to>103</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>45</Hsp_identity>
|
||||
<Hsp_positive>66</Hsp_positive>
|
||||
<Hsp_gaps>5</Hsp_gaps>
|
||||
<Hsp_align-len>104</Hsp_align-len>
|
||||
<Hsp_qseq>MKKFIALLFFILL----LSGCGVNSQKSQGEDVSPDSNIETKEGTYVGLADTHTIEVTVDNEPVSLDITEESTSDLDKFNSGDKVTITYEKNDEGQLLLKDIER</Hsp_qseq>
|
||||
<Hsp_hseq>MKKNVASSFLILLFSIILAACGTAEQSKEG-NGSSSSQVQNETAYYVGMADTHTIEVKIDDQPVSFEFTDDFSEILNEFEENDKVNISYLTNDKGQKELTEIEK</Hsp_hseq>
|
||||
<Hsp_midline>MKK +A F ILL L+ CG Q +G + S S ++ + YVG+ADTHTIEV +D++PVS + T++ + L++F DKV I+Y ND+GQ L +IE+</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>5</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|15</Hit_id>
|
||||
<Hit_def>gi|332258565|ref|XP_003278367.1| PREDICTED: UPF0764 protein C16orf89-like [Nomascus leucogenys]</Hit_def>
|
||||
<Hit_accession>15</Hit_accession>
|
||||
<Hit_len>132</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>15.779</Hsp_bit-score>
|
||||
<Hsp_score>29</Hsp_score>
|
||||
<Hsp_evalue>7.12269</Hsp_evalue>
|
||||
<Hsp_query-from>60</Hsp_query-from>
|
||||
<Hsp_query-to>84</Hsp_query-to>
|
||||
<Hsp_hit-from>80</Hsp_hit-from>
|
||||
<Hsp_hit-to>104</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>7</Hsp_identity>
|
||||
<Hsp_positive>11</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>25</Hsp_align-len>
|
||||
<Hsp_qseq>VSLDITEESTSDLDKFNSGDKVTIT</Hsp_qseq>
|
||||
<Hsp_hseq>VEMGFLHVGQAGLELVTSGDPPTLT</Hsp_hseq>
|
||||
<Hsp_midline>V + + L+ SGD T+T</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
</Iteration_hits>
|
||||
<Iteration_stat>
|
||||
<Statistics>
|
||||
<Statistics_db-num>20</Statistics_db-num>
|
||||
<Statistics_db-len>6406</Statistics_db-len>
|
||||
<Statistics_hsp-len>38</Statistics_hsp-len>
|
||||
<Statistics_eff-space>361344</Statistics_eff-space>
|
||||
<Statistics_kappa>0.041</Statistics_kappa>
|
||||
<Statistics_lambda>0.267</Statistics_lambda>
|
||||
<Statistics_entropy>0.14</Statistics_entropy>
|
||||
</Statistics>
|
||||
</Iteration_stat>
|
||||
</Iteration>
|
||||
"""
|
||||
self.check_raw(filename, "gi|16080617|ref|NP_391444.1|", raw)
|
||||
|
||||
def test_blastxml_2226_multiple_last(self):
|
||||
"""Test blast-xml raw string retrieval, BLAST 2.2.26+, multiple queries, last (xml_2226_blastp_001.xml)"""
|
||||
filename = 'Blast/xml_2226_blastp_001.xml'
|
||||
raw = """ <Iteration>
|
||||
<Iteration_iter-num>3</Iteration_iter-num>
|
||||
<Iteration_query-ID>Query_3</Iteration_query-ID>
|
||||
<Iteration_query-def>gi|11464971:4-101 pleckstrin [Mus musculus]</Iteration_query-def>
|
||||
<Iteration_query-len>98</Iteration_query-len>
|
||||
<Iteration_hits>
|
||||
<Hit>
|
||||
<Hit_num>1</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|5</Hit_id>
|
||||
<Hit_def>gi|11464971|ref|NP_062422.1| pleckstrin [Mus musculus]</Hit_def>
|
||||
<Hit_accession>5</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>205.682</Hsp_bit-score>
|
||||
<Hsp_score>522</Hsp_score>
|
||||
<Hsp_evalue>2.24956e-69</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>98</Hsp_identity>
|
||||
<Hsp_positive>98</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>43.5134</Hsp_bit-score>
|
||||
<Hsp_score>101</Hsp_score>
|
||||
<Hsp_evalue>2.90061e-09</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>29</Hsp_identity>
|
||||
<Hsp_positive>48</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTS--PCQDFGK--RMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGGEDPLGAVHLRGCVVTSVESSHDVKKSDEENLFEIITADEVHYYLQAATSKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G + L+G +TS D K + +I T + ++ QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>2</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|6</Hit_id>
|
||||
<Hit_def>gi|354480464|ref|XP_003502426.1| PREDICTED: pleckstrin-like [Cricetulus griseus]</Hit_def>
|
||||
<Hit_accession>6</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>205.297</Hsp_bit-score>
|
||||
<Hsp_score>521</Hsp_score>
|
||||
<Hsp_evalue>3.2078e-69</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>98</Hsp_identity>
|
||||
<Hsp_positive>98</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>43.8986</Hsp_bit-score>
|
||||
<Hsp_score>102</Hsp_score>
|
||||
<Hsp_evalue>1.81272e-09</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>30</Hsp_identity>
|
||||
<Hsp_positive>50</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTSPCQDF-GKRM---FVLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGGEDPLGAIHLRGCVVTSVESNHDGKKSDDENLFEIITADEVHYYLQAAAPKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G I L+G +TS + GK+ + +I T + ++ QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>3</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|7</Hit_id>
|
||||
<Hit_def>gi|156616273|ref|NP_002655.2| pleckstrin [Homo sapiens]</Hit_def>
|
||||
<Hit_accession>7</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>204.142</Hsp_bit-score>
|
||||
<Hsp_score>518</Hsp_score>
|
||||
<Hsp_evalue>1.081e-68</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>97</Hsp_identity>
|
||||
<Hsp_positive>97</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFV KITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>47.3654</Hsp_bit-score>
|
||||
<Hsp_score>111</Hsp_score>
|
||||
<Hsp_evalue>1.50729e-10</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>31</Hsp_identity>
|
||||
<Hsp_positive>48</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMF----VLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G I L+G +TS + R + +I T + +F QAA +ER W+R I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>4</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|8</Hit_id>
|
||||
<Hit_def>gi|297667453|ref|XP_002811995.1| PREDICTED: pleckstrin-like [Pongo abelii]</Hit_def>
|
||||
<Hit_accession>8</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>204.142</Hsp_bit-score>
|
||||
<Hsp_score>518</Hsp_score>
|
||||
<Hsp_evalue>1.10449e-68</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>97</Hsp_identity>
|
||||
<Hsp_positive>97</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFV KITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>45.4394</Hsp_bit-score>
|
||||
<Hsp_score>106</Hsp_score>
|
||||
<Hsp_evalue>6.1425e-10</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>30</Hsp_identity>
|
||||
<Hsp_positive>48</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMF----VLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G I L+G +TS + R + +I T + +F QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>5</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|9</Hit_id>
|
||||
<Hit_def>gi|350596020|ref|XP_003360649.2| PREDICTED: pleckstrin-like [Sus scrofa]</Hit_def>
|
||||
<Hit_accession>9</Hit_accession>
|
||||
<Hit_len>228</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>199.519</Hsp_bit-score>
|
||||
<Hsp_score>506</Hsp_score>
|
||||
<Hsp_evalue>1.97058e-68</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>94</Hsp_identity>
|
||||
<Hsp_positive>96</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSMFNTWKPMWVILLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDGWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGS+FNTWKPMWV+LLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFV KITTTKQQDHFFQAAFLEERD WVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>32.3426</Hsp_bit-score>
|
||||
<Hsp_score>72</Hsp_score>
|
||||
<Hsp_evalue>1.12281e-05</Hsp_evalue>
|
||||
<Hsp_query-from>30</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>153</Hsp_hit-from>
|
||||
<Hsp_hit-to>223</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>21</Hsp_identity>
|
||||
<Hsp_positive>32</Hsp_positive>
|
||||
<Hsp_gaps>4</Hsp_gaps>
|
||||
<Hsp_align-len>71</Hsp_align-len>
|
||||
<Hsp_qseq>IEFYKKKSDNSPKGMIPLKGSTLTS-PCQDFGKRMFV---LKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>LHYYDPAGGEDPLGAIHLRGCVVTSVESNTDGKNGFLWERAXXITADEVHYFLQAANPKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>+ +Y P G I L+G +TS GK F+ T + +F QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
</Iteration_hits>
|
||||
<Iteration_stat>
|
||||
<Statistics>
|
||||
<Statistics_db-num>20</Statistics_db-num>
|
||||
<Statistics_db-len>6406</Statistics_db-len>
|
||||
<Statistics_hsp-len>37</Statistics_hsp-len>
|
||||
<Statistics_eff-space>345626</Statistics_eff-space>
|
||||
<Statistics_kappa>0.041</Statistics_kappa>
|
||||
<Statistics_lambda>0.267</Statistics_lambda>
|
||||
<Statistics_entropy>0.14</Statistics_entropy>
|
||||
</Statistics>
|
||||
</Iteration_stat>
|
||||
</Iteration>
|
||||
"""
|
||||
self.check_raw(filename, "gi|11464971:4-101", raw)
|
||||
|
||||
def test_blastxml_2226_single(self):
|
||||
"""Test blast-xml raw string retrieval, BLAST 2.2.26+, single query (xml_2226_blastp_004.xml)"""
|
||||
filename = 'Blast/xml_2226_blastp_004.xml'
|
||||
raw = """ <Iteration>
|
||||
<Iteration_iter-num>1</Iteration_iter-num>
|
||||
<Iteration_query-ID>Query_1</Iteration_query-ID>
|
||||
<Iteration_query-def>gi|11464971:4-101 pleckstrin [Mus musculus]</Iteration_query-def>
|
||||
<Iteration_query-len>98</Iteration_query-len>
|
||||
<Iteration_hits>
|
||||
<Hit>
|
||||
<Hit_num>1</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|5</Hit_id>
|
||||
<Hit_def>gi|11464971|ref|NP_062422.1| pleckstrin [Mus musculus]</Hit_def>
|
||||
<Hit_accession>5</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>205.682</Hsp_bit-score>
|
||||
<Hsp_score>522</Hsp_score>
|
||||
<Hsp_evalue>2.24956e-69</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>98</Hsp_identity>
|
||||
<Hsp_positive>98</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>43.5134</Hsp_bit-score>
|
||||
<Hsp_score>101</Hsp_score>
|
||||
<Hsp_evalue>2.90061e-09</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>29</Hsp_identity>
|
||||
<Hsp_positive>48</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTS--PCQDFGK--RMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGGEDPLGAVHLRGCVVTSVESSHDVKKSDEENLFEIITADEVHYYLQAATSKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G + L+G +TS D K + +I T + ++ QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>2</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|6</Hit_id>
|
||||
<Hit_def>gi|354480464|ref|XP_003502426.1| PREDICTED: pleckstrin-like [Cricetulus griseus]</Hit_def>
|
||||
<Hit_accession>6</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>205.297</Hsp_bit-score>
|
||||
<Hsp_score>521</Hsp_score>
|
||||
<Hsp_evalue>3.2078e-69</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>98</Hsp_identity>
|
||||
<Hsp_positive>98</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>43.8986</Hsp_bit-score>
|
||||
<Hsp_score>102</Hsp_score>
|
||||
<Hsp_evalue>1.81272e-09</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>30</Hsp_identity>
|
||||
<Hsp_positive>50</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTSPCQDF-GKRM---FVLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGGEDPLGAIHLRGCVVTSVESNHDGKKSDDENLFEIITADEVHYYLQAAAPKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G I L+G +TS + GK+ + +I T + ++ QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>3</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|7</Hit_id>
|
||||
<Hit_def>gi|156616273|ref|NP_002655.2| pleckstrin [Homo sapiens]</Hit_def>
|
||||
<Hit_accession>7</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>204.142</Hsp_bit-score>
|
||||
<Hsp_score>518</Hsp_score>
|
||||
<Hsp_evalue>1.081e-68</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>97</Hsp_identity>
|
||||
<Hsp_positive>97</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFV KITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>47.3654</Hsp_bit-score>
|
||||
<Hsp_score>111</Hsp_score>
|
||||
<Hsp_evalue>1.50729e-10</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>31</Hsp_identity>
|
||||
<Hsp_positive>48</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMF----VLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G I L+G +TS + R + +I T + +F QAA +ER W+R I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>4</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|8</Hit_id>
|
||||
<Hit_def>gi|297667453|ref|XP_002811995.1| PREDICTED: pleckstrin-like [Pongo abelii]</Hit_def>
|
||||
<Hit_accession>8</Hit_accession>
|
||||
<Hit_len>350</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>204.142</Hsp_bit-score>
|
||||
<Hsp_score>518</Hsp_score>
|
||||
<Hsp_evalue>1.10449e-68</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>97</Hsp_identity>
|
||||
<Hsp_positive>97</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFV KITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>45.4394</Hsp_bit-score>
|
||||
<Hsp_score>106</Hsp_score>
|
||||
<Hsp_evalue>6.1425e-10</Hsp_evalue>
|
||||
<Hsp_query-from>3</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>246</Hsp_hit-from>
|
||||
<Hsp_hit-to>345</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>30</Hsp_identity>
|
||||
<Hsp_positive>48</Hsp_positive>
|
||||
<Hsp_gaps>6</Hsp_gaps>
|
||||
<Hsp_align-len>100</Hsp_align-len>
|
||||
<Hsp_qseq>IREGYLVKKGSVFNTWKPMWVVLLEDG--IEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMF----VLKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>IKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>I++G L+K+G WK +L ED + +Y P G I L+G +TS + R + +I T + +F QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
<Hit>
|
||||
<Hit_num>5</Hit_num>
|
||||
<Hit_id>gnl|BL_ORD_ID|9</Hit_id>
|
||||
<Hit_def>gi|350596020|ref|XP_003360649.2| PREDICTED: pleckstrin-like [Sus scrofa]</Hit_def>
|
||||
<Hit_accession>9</Hit_accession>
|
||||
<Hit_len>228</Hit_len>
|
||||
<Hit_hsps>
|
||||
<Hsp>
|
||||
<Hsp_num>1</Hsp_num>
|
||||
<Hsp_bit-score>199.519</Hsp_bit-score>
|
||||
<Hsp_score>506</Hsp_score>
|
||||
<Hsp_evalue>1.97058e-68</Hsp_evalue>
|
||||
<Hsp_query-from>1</Hsp_query-from>
|
||||
<Hsp_query-to>98</Hsp_query-to>
|
||||
<Hsp_hit-from>4</Hsp_hit-from>
|
||||
<Hsp_hit-to>101</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>94</Hsp_identity>
|
||||
<Hsp_positive>96</Hsp_positive>
|
||||
<Hsp_gaps>0</Hsp_gaps>
|
||||
<Hsp_align-len>98</Hsp_align-len>
|
||||
<Hsp_qseq>KRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIK</Hsp_qseq>
|
||||
<Hsp_hseq>KRIREGYLVKKGSMFNTWKPMWVILLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDGWVRDIKKAIK</Hsp_hseq>
|
||||
<Hsp_midline>KRIREGYLVKKGS+FNTWKPMWV+LLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFV KITTTKQQDHFFQAAFLEERD WVRDIKKAIK</Hsp_midline>
|
||||
</Hsp>
|
||||
<Hsp>
|
||||
<Hsp_num>2</Hsp_num>
|
||||
<Hsp_bit-score>32.3426</Hsp_bit-score>
|
||||
<Hsp_score>72</Hsp_score>
|
||||
<Hsp_evalue>1.12281e-05</Hsp_evalue>
|
||||
<Hsp_query-from>30</Hsp_query-from>
|
||||
<Hsp_query-to>96</Hsp_query-to>
|
||||
<Hsp_hit-from>153</Hsp_hit-from>
|
||||
<Hsp_hit-to>223</Hsp_hit-to>
|
||||
<Hsp_query-frame>0</Hsp_query-frame>
|
||||
<Hsp_hit-frame>0</Hsp_hit-frame>
|
||||
<Hsp_identity>21</Hsp_identity>
|
||||
<Hsp_positive>32</Hsp_positive>
|
||||
<Hsp_gaps>4</Hsp_gaps>
|
||||
<Hsp_align-len>71</Hsp_align-len>
|
||||
<Hsp_qseq>IEFYKKKSDNSPKGMIPLKGSTLTS-PCQDFGKRMFV---LKITTTKQQDHFFQAAFLEERDAWVRDIKKA</Hsp_qseq>
|
||||
<Hsp_hseq>LHYYDPAGGEDPLGAIHLRGCVVTSVESNTDGKNGFLWERAXXITADEVHYFLQAANPKERTEWIKAIQVA</Hsp_hseq>
|
||||
<Hsp_midline>+ +Y P G I L+G +TS GK F+ T + +F QAA +ER W++ I+ A</Hsp_midline>
|
||||
</Hsp>
|
||||
</Hit_hsps>
|
||||
</Hit>
|
||||
</Iteration_hits>
|
||||
<Iteration_stat>
|
||||
<Statistics>
|
||||
<Statistics_db-num>20</Statistics_db-num>
|
||||
<Statistics_db-len>6406</Statistics_db-len>
|
||||
<Statistics_hsp-len>37</Statistics_hsp-len>
|
||||
<Statistics_eff-space>345626</Statistics_eff-space>
|
||||
<Statistics_kappa>0.041</Statistics_kappa>
|
||||
<Statistics_lambda>0.267</Statistics_lambda>
|
||||
<Statistics_entropy>0.14</Statistics_entropy>
|
||||
</Statistics>
|
||||
</Iteration_stat>
|
||||
</Iteration>
|
||||
"""
|
||||
self.check_raw(filename, "gi|11464971:4-101", raw)
|
||||
|
||||
|
||||
class BlastXmlIndexCases(CheckIndex):
|
||||
|
||||
fmt = 'blast-xml'
|
||||
|
||||
def test_blastxml_2212L_blastp_001(self):
|
||||
"""Test blast-xml indexing, BLAST 2.2.12"""
|
||||
filename = 'Blast/xml_2212L_blastp_001.xml'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blastxml_2218_blastp_001(self):
|
||||
"""Test blast-xml indexing, BLAST 2.2.18+"""
|
||||
filename = 'Blast/xml_2218_blastp_001.xml'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blastxml_2222_blastx_001(self):
|
||||
"""Test blast-xml indexing, BLAST 2.2.22+"""
|
||||
filename = 'Blast/xml_2222_blastx_001.xml'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blastxml_2226_tblastn_001(self):
|
||||
"""Test blast-xml indexing, BLAST 2.2.26+, multiple queries"""
|
||||
filename = 'Blast/xml_2226_tblastn_001.xml'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blastxml_2226_tblastn_002(self):
|
||||
"""Test blast-xml indexing, BlAST 2.2.26+, single query, no hits"""
|
||||
filename = 'Blast/xml_2226_tblastn_002.xml'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_blastxml_2226_tblastn_004(self):
|
||||
"""Test blast-xml indexing, BLAST 2.2.26+, single query, multiple hits"""
|
||||
filename = 'Blast/xml_2226_tblastn_004.xml'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
71
Tests/test_SearchIO_blat_psl_index.py
Normal file
71
Tests/test_SearchIO_blat_psl_index.py
Normal file
@ -0,0 +1,71 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO blat-psl indexing."""
|
||||
|
||||
import os
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckIndex
|
||||
|
||||
|
||||
class BlatPslIndexCases(CheckIndex):
|
||||
|
||||
fmt = 'blat-psl'
|
||||
|
||||
def test_psl_34_001(self):
|
||||
"""Test blat-psl indexing, multiple queries"""
|
||||
filename = os.path.join('Blat', 'psl_34_001.psl')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_psl_34_002(self):
|
||||
"""Test blat-psl indexing, single query, no hits"""
|
||||
filename = os.path.join('Blat', 'psl_34_002.psl')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_psl_34_003(self):
|
||||
"""Test blat-psl indexing, single query, single hit"""
|
||||
filename = os.path.join('Blat', 'psl_34_003.psl')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_psl_34_004(self):
|
||||
"""Test blat-psl indexing, single query, multiple hits with multiple hsps"""
|
||||
filename = os.path.join('Blat', 'psl_34_004.psl')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_psl_34_005(self):
|
||||
"""Test blat-psl indexing, multiple queries, no header"""
|
||||
filename = os.path.join('Blat', 'psl_34_005.psl')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_psl_34_006(self):
|
||||
"""Test blat-pslx indexing, multiple queries"""
|
||||
filename = os.path.join('Blat', 'pslx_34_001.pslx')
|
||||
self.check_index(filename, self.fmt, pslx=True)
|
||||
|
||||
def test_psl_34_007(self):
|
||||
"""Test blat-pslx indexing, single query, no hits"""
|
||||
filename = os.path.join('Blat', 'pslx_34_002.pslx')
|
||||
self.check_index(filename, self.fmt, pslx=True)
|
||||
|
||||
def test_psl_34_008(self):
|
||||
"""Test blat-pslx indexing, single query, single hit"""
|
||||
filename = os.path.join('Blat', 'pslx_34_003.pslx')
|
||||
self.check_index(filename, self.fmt, pslx=True)
|
||||
|
||||
def test_psl_34_009(self):
|
||||
"""Test blat-pslx indexing, single query, multiple hits with multiple hsps"""
|
||||
filename = os.path.join('Blat', 'pslx_34_004.pslx')
|
||||
self.check_index(filename, self.fmt, pslx=True)
|
||||
|
||||
def test_psl_34_010(self):
|
||||
"""Test blat-pslx indexing, multiple queries, no header"""
|
||||
filename = os.path.join('Blat', 'pslx_34_005.pslx')
|
||||
self.check_index(filename, self.fmt, pslx=True)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
31
Tests/test_SearchIO_exonerate_text_index.py
Normal file
31
Tests/test_SearchIO_exonerate_text_index.py
Normal file
@ -0,0 +1,31 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO exonerate-text indexing."""
|
||||
|
||||
import os
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckIndex
|
||||
|
||||
|
||||
class ExonerateTextIndexCases(CheckIndex):
|
||||
|
||||
fmt = 'exonerate-text'
|
||||
|
||||
def test_exn_22_m_est2genome(self):
|
||||
"""Test exonerate-text indexing, single"""
|
||||
filename = os.path.join('Exonerate', 'exn_22_m_est2genome.exn')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_exn_22_q_multiple(self):
|
||||
"""Test exonerate-text indexing, single"""
|
||||
filename = os.path.join('Exonerate', 'exn_22_q_multiple.exn')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
31
Tests/test_SearchIO_exonerate_vulgar_index.py
Normal file
31
Tests/test_SearchIO_exonerate_vulgar_index.py
Normal file
@ -0,0 +1,31 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO exonerate-vulgar indexing."""
|
||||
|
||||
import os
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckIndex
|
||||
|
||||
|
||||
class ExonerateVulgarIndexCases(CheckIndex):
|
||||
|
||||
fmt = 'exonerate-vulgar'
|
||||
|
||||
def test_exn_22_m_est2genome(self):
|
||||
"""Test exonerate-vulgar indexing, single"""
|
||||
filename = os.path.join('Exonerate', 'exn_22_o_vulgar.exn')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_exn_22_q_multiple(self):
|
||||
"""Test exonerate-vulgar indexing, single"""
|
||||
filename = os.path.join('Exonerate', 'exn_22_q_multiple_vulgar.exn')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
61
Tests/test_SearchIO_fasta_m10_index.py
Normal file
61
Tests/test_SearchIO_fasta_m10_index.py
Normal file
@ -0,0 +1,61 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO fasta-m10 indexing."""
|
||||
|
||||
import os
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckIndex
|
||||
|
||||
|
||||
class FastaM10IndexCases(CheckIndex):
|
||||
|
||||
fmt = 'fasta-m10'
|
||||
|
||||
def test_output_002(self):
|
||||
"""Test fasta-m10 indexing, fasta34, multiple queries"""
|
||||
filename = os.path.join('Fasta', 'output002.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_output_001(self):
|
||||
"""Test fasta-m10 indexing, fasta35, multiple queries"""
|
||||
filename = os.path.join('Fasta', 'output001.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_output_005(self):
|
||||
"""Test fasta-m10 indexing, ssearch35, multiple queries"""
|
||||
filename = os.path.join('Fasta', 'output005.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_output_008(self):
|
||||
"""Test fasta-m10 indexing, tfastx36, multiple queries"""
|
||||
filename = os.path.join('Fasta', 'output008.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_output_009(self):
|
||||
"""Test fasta-m10 indexing, fasta36, multiple queries"""
|
||||
filename = os.path.join('Fasta', 'output009.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_output_010(self):
|
||||
"""Test fasta-m10 indexing, fasta36, single query, no hits"""
|
||||
filename = os.path.join('Fasta', 'output010.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_output_011(self):
|
||||
"""Test fasta-m10 indexing, fasta36, single query, hits with single hsp"""
|
||||
filename = os.path.join('Fasta', 'output011.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_output_012(self):
|
||||
"""Test fasta-m10 indexing, fasta36, single query with multiple hsps"""
|
||||
filename = os.path.join('Fasta', 'output012.m10')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
84
Tests/test_SearchIO_hmmer3_domtab_index.py
Normal file
84
Tests/test_SearchIO_hmmer3_domtab_index.py
Normal file
@ -0,0 +1,84 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO hmmer3-domtab indexing."""
|
||||
|
||||
import os
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckRaw, CheckIndex
|
||||
|
||||
|
||||
class HmmerDomtabRawCases(CheckRaw):
|
||||
|
||||
fmt = 'hmmscan3-domtab'
|
||||
|
||||
def test_hmmerdomtab_30_multiple_first(self):
|
||||
"""Test hmmscan-domtab raw string retrieval, HMMER 3.0, multiple queries, first (domtab_30_hmmscan_001.out)"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_001.out')
|
||||
raw = """Globin PF00042.17 108 gi|4885477|ref|NP_005359.1| - 154 6e-21 74.6 0.3 1 1 6.7e-25 9.2e-21 74.0 0.2 1 107 7 112 7 113 0.97 Globin
|
||||
"""
|
||||
self.check_raw(filename, "gi|4885477|ref|NP_005359.1|", raw)
|
||||
|
||||
def test_hmmerdomtab_30_multiple_middle(self):
|
||||
"""Test hmmscan-domtab raw string retrieval, HMMER 3.0, multiple queries, middle (domtab_30_hmmscan_001.out)"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_001.out')
|
||||
raw = """Ig_3 PF13927.1 75 gi|126362951:116-221 - 106 1.4e-09 38.2 0.4 1 1 3e-13 2.1e-09 37.6 0.3 1 73 9 84 9 88 0.94 Immunoglobulin domain
|
||||
Ig_2 PF13895.1 80 gi|126362951:116-221 - 106 3.5e-05 23.7 0.1 1 1 6.2e-09 4.3e-05 23.4 0.1 1 80 9 104 9 104 0.71 Immunoglobulin domain
|
||||
"""
|
||||
self.check_raw(filename, "gi|126362951:116-221", raw)
|
||||
|
||||
def test_hmmerdomtab_30_multiple_last(self):
|
||||
"""Test hmmscan-domtab raw string retrieval, HMMER 3.0, multiple queries, last (domtab_30_hmmscan_001.out)"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_001.out')
|
||||
raw = """Pou PF00157.12 75 gi|125490392|ref|NP_038661.2| - 352 7e-37 124.8 0.5 1 1 5e-40 1.4e-36 123.9 0.3 3 75 133 205 131 205 0.97 Pou domain - N-terminal to homeobox domain
|
||||
Homeobox PF00046.24 57 gi|125490392|ref|NP_038661.2| - 352 2.1e-18 65.5 1.1 1 1 1.5e-21 4.1e-18 64.6 0.7 1 57 224 280 224 280 0.98 Homeobox domain
|
||||
HTH_31 PF13560.1 64 gi|125490392|ref|NP_038661.2| - 352 0.012 15.6 0.0 1 2 5.7e-05 0.16 12.0 0.0 1 35 141 181 141 184 0.96 Helix-turn-helix domain
|
||||
HTH_31 PF13560.1 64 gi|125490392|ref|NP_038661.2| - 352 0.012 15.6 0.0 2 2 0.19 5.2e+02 0.8 0.0 39 62 245 268 243 270 0.86 Helix-turn-helix domain
|
||||
Homeobox_KN PF05920.6 40 gi|125490392|ref|NP_038661.2| - 352 0.039 13.5 0.0 1 1 3.5e-05 0.095 12.3 0.0 7 39 244 276 241 277 0.91 Homeobox KN domain
|
||||
DUF521 PF04412.8 400 gi|125490392|ref|NP_038661.2| - 352 0.14 10.5 0.1 1 1 9.4e-05 0.26 9.6 0.1 273 334 221 280 197 294 0.77 Protein of unknown function (DUF521)
|
||||
"""
|
||||
self.check_raw(filename, "gi|125490392|ref|NP_038661.2|", raw)
|
||||
|
||||
def test_hmmerdomtab_30_single(self):
|
||||
"""Test hmmscan-domtab raw string retrieval, HMMER 3.0, single query (domtab_30_hmmscan_004.out)"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_004.out')
|
||||
raw = """Ig_3 PF13927.1 75 gi|126362951:116-221 - 106 1.4e-09 38.2 0.4 1 1 3e-13 2.1e-09 37.6 0.3 1 73 9 84 9 88 0.94 Immunoglobulin domain
|
||||
Ig_2 PF13895.1 80 gi|126362951:116-221 - 106 3.5e-05 23.7 0.1 1 1 6.2e-09 4.3e-05 23.4 0.1 1 80 9 104 9 104 0.71 Immunoglobulin domain
|
||||
"""
|
||||
self.check_raw(filename, "gi|126362951:116-221", raw)
|
||||
|
||||
|
||||
class HmmerDomtabIndexCases(CheckIndex):
|
||||
|
||||
def test_hmmerdomtab_30_hmmscan_001(self):
|
||||
"""Test hmmscan-domtab indexing, HMMER 3.0, multiple queries"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_001.out')
|
||||
self.check_index(filename, 'hmmscan3-domtab')
|
||||
|
||||
def test_hmmerdomtab_30_hmmscan_002(self):
|
||||
"""Test hmmscan-domtab indexing, HMMER 3.0, single query, no hits"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_002.out')
|
||||
self.check_index(filename, 'hmmscan3-domtab')
|
||||
|
||||
def test_hmmerdomtab_30_hmmscan_003(self):
|
||||
"""Test hmmscan-domtab indexing, HMMER 3.0, single query, multiple hits"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_003.out')
|
||||
self.check_index(filename, 'hmmscan3-domtab')
|
||||
|
||||
def test_hmmerdomtab_30_hmmscan_004(self):
|
||||
"""Test hmmscan-domtab indexing, HMMER 3.0, single query, no alignments"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmscan_004.out')
|
||||
self.check_index(filename, 'hmmscan3-domtab')
|
||||
|
||||
def test_hmmerdomtab_30_hmmsearch_001(self):
|
||||
"""Test hmmsearch-domtab indexing, HMMER 3.0, single query, no alignments"""
|
||||
filename = os.path.join('Hmmer', 'domtab_30_hmmsearch_001.out')
|
||||
self.check_index(filename, 'hmmsearch3-domtab')
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
80
Tests/test_SearchIO_hmmer3_tab_index.py
Normal file
80
Tests/test_SearchIO_hmmer3_tab_index.py
Normal file
@ -0,0 +1,80 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO hmmer3-tab indexing."""
|
||||
|
||||
import os
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckRaw, CheckIndex
|
||||
|
||||
|
||||
class Hmmer3TabRawCases(CheckRaw):
|
||||
|
||||
fmt = 'hmmer3-tab'
|
||||
|
||||
def test_hmmer3tab_30_multiple_first(self):
|
||||
"""Test hmmer3-tab raw string retrieval, HMMER 3.0, multiple queries, first (tab_30_hmmscan_001.out)"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_001.out')
|
||||
raw = """Globin PF00042.17 gi|4885477|ref|NP_005359.1| - 6e-21 74.6 0.3 9.2e-21 74.0 0.2 1.3 1 0 0 1 1 1 1 Globin
|
||||
"""
|
||||
self.check_raw(filename, "gi|4885477|ref|NP_005359.1|", raw)
|
||||
|
||||
def test_hmmer3tab_30_multiple_middle(self):
|
||||
"""Test hmmer3-tab raw string retrieval, HMMER 3.0, multiple queries, middle (tab_30_hmmscan_001.out)"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_001.out')
|
||||
raw = """Ig_3 PF13927.1 gi|126362951:116-221 - 1.4e-09 38.2 0.4 2.1e-09 37.6 0.3 1.3 1 0 0 1 1 1 1 Immunoglobulin domain
|
||||
Ig_2 PF13895.1 gi|126362951:116-221 - 3.5e-05 23.7 0.1 4.3e-05 23.4 0.1 1.1 1 0 0 1 1 1 1 Immunoglobulin domain
|
||||
"""
|
||||
self.check_raw(filename, "gi|126362951:116-221", raw)
|
||||
|
||||
def test_hmmer3tab_30_multiple_last(self):
|
||||
"""Test hmmer3-tab raw string retrieval, HMMER 3.0, multiple queries, last (tab_30_hmmscan_001.out)"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_001.out')
|
||||
raw = """Pou PF00157.12 gi|125490392|ref|NP_038661.2| - 7e-37 124.8 0.5 1.4e-36 123.9 0.3 1.5 1 0 0 1 1 1 1 Pou domain - N-terminal to homeobox domain
|
||||
Homeobox PF00046.24 gi|125490392|ref|NP_038661.2| - 2.1e-18 65.5 1.1 4.1e-18 64.6 0.7 1.5 1 0 0 1 1 1 1 Homeobox domain
|
||||
HTH_31 PF13560.1 gi|125490392|ref|NP_038661.2| - 0.012 15.6 0.0 0.16 12.0 0.0 2.2 2 0 0 2 2 2 0 Helix-turn-helix domain
|
||||
Homeobox_KN PF05920.6 gi|125490392|ref|NP_038661.2| - 0.039 13.5 0.0 0.095 12.3 0.0 1.6 1 0 0 1 1 1 0 Homeobox KN domain
|
||||
DUF521 PF04412.8 gi|125490392|ref|NP_038661.2| - 0.14 10.5 0.1 0.26 9.6 0.1 1.4 1 0 0 1 1 1 0 Protein of unknown function (DUF521)
|
||||
"""
|
||||
self.check_raw(filename, "gi|125490392|ref|NP_038661.2|", raw)
|
||||
|
||||
def test_hmmer3tab_30_single(self):
|
||||
"""Test hmmer3-tab raw string retrieval, HMMER 3.0, single query (tab_30_hmmscan_004.out)"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_004.out')
|
||||
raw = """Ig_3 PF13927.1 gi|126362951:116-221 - 1.4e-09 38.2 0.4 2.1e-09 37.6 0.3 1.3 1 0 0 1 1 1 1 Immunoglobulin domain
|
||||
Ig_2 PF13895.1 gi|126362951:116-221 - 3.5e-05 23.7 0.1 4.3e-05 23.4 0.1 1.1 1 0 0 1 1 1 1 Immunoglobulin domain
|
||||
"""
|
||||
self.check_raw(filename, "gi|126362951:116-221", raw)
|
||||
|
||||
|
||||
class Hmmer3TabIndexCases(CheckIndex):
|
||||
|
||||
fmt = 'hmmer3-tab'
|
||||
|
||||
def test_hmmer3tab_30_hmmscan_001(self):
|
||||
"""Test hmmer3-tab indexing, HMMER 3.0, multiple queries"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_001.out')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmer3tab_30_hmmscan_002(self):
|
||||
"""Test hmmer3-tab indexing, HMMER 3.0, single query, no hits"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_002.out')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmer3tab_30_hmmscan_003(self):
|
||||
"""Test hmmer3-tab indexing, HMMER 3.0, single query, multiple hits"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_003.out')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmer3tab_30_hmmscan_004(self):
|
||||
"""Test hmmer3-tab indexing, HMMER 3.0, single query, no alignments"""
|
||||
filename = os.path.join('Hmmer', 'tab_30_hmmscan_004.out')
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
340
Tests/test_SearchIO_hmmer3_text_index.py
Normal file
340
Tests/test_SearchIO_hmmer3_text_index.py
Normal file
@ -0,0 +1,340 @@
|
||||
# Copyright 2012 by Wibowo Arindrarto. All rights reserved.
|
||||
# This code is part of the Biopython distribution and governed by its
|
||||
# license. Please see the LICENSE file that should have been included
|
||||
# as part of this package.
|
||||
|
||||
"""Tests for SearchIO hmmer3-text indexing."""
|
||||
|
||||
import unittest
|
||||
|
||||
from search_tests_common import CheckRaw, CheckIndex
|
||||
|
||||
|
||||
class Hmmer3TextRawCases(CheckRaw):
|
||||
|
||||
fmt = 'hmmer3-text'
|
||||
|
||||
def test_hmmer3text_30_multiple_first(self):
|
||||
"""Test hmmer3-text raw string retrieval, HMMER 3.0, multiple queries, first (text_30_hmmscan_001.out)"""
|
||||
filename = 'Hmmer/text_30_hmmscan_001.out'
|
||||
raw = """# hmmscan :: search sequence(s) against a profile database
|
||||
# HMMER 3.0 (March 2010); http://hmmer.org/
|
||||
# Copyright (C) 2010 Howard Hughes Medical Institute.
|
||||
# Freely distributed under the GNU General Public License (GPLv3).
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
# query sequence file: mult.fasta
|
||||
# target HMM database: /home/bow/db/hmmer/Pfam-A.hmm
|
||||
# output directed to file: hmmer_cases/text_hmmscan_mult.out
|
||||
# per-seq hits tabular output: hmmer_cases/tab_hmmscan_mult.out
|
||||
# per-dom hits tabular output: hmmer_cases/domtab_hmmscan_mult.out
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
|
||||
Query: random_s00 [L=32]
|
||||
Scores for complete sequence (score includes all domains):
|
||||
--- full sequence --- --- best 1 domain --- -#dom-
|
||||
E-value score bias E-value score bias exp N Model Description
|
||||
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
|
||||
|
||||
[No hits detected that satisfy reporting thresholds]
|
||||
|
||||
|
||||
Domain annotation for each model (and alignments):
|
||||
|
||||
[No targets detected that satisfy reporting thresholds]
|
||||
|
||||
|
||||
Internal pipeline statistics summary:
|
||||
-------------------------------------
|
||||
Query sequence(s): 1 (32 residues)
|
||||
Target model(s): 13672 (2396357 nodes)
|
||||
Passed MSV filter: 338 (0.0247221); expected 273.4 (0.02)
|
||||
Passed bias filter: 87 (0.00636337); expected 273.4 (0.02)
|
||||
Passed Vit filter: 23 (0.00168227); expected 13.7 (0.001)
|
||||
Passed Fwd filter: 14 (0.00102399); expected 0.1 (1e-05)
|
||||
Initial search space (Z): 13672 [actual number of targets]
|
||||
Domain search space (domZ): 0 [number of targets reported over threshold]
|
||||
# CPU time: 0.20u 0.12s 00:00:00.32 Elapsed: 00:00:00.19
|
||||
# Mc/sec: 403.60
|
||||
//
|
||||
"""
|
||||
self.check_raw(filename, "random_s00", raw)
|
||||
|
||||
def test_hmmer3text_30_multiple_middle(self):
|
||||
"""Test hmmer3-text raw string retrieval, HMMER 3.0, multiple queries, middle (text_30_hmmscan_001.out)"""
|
||||
filename = 'Hmmer/text_30_hmmscan_001.out'
|
||||
raw = """# hmmscan :: search sequence(s) against a profile database
|
||||
# HMMER 3.0 (March 2010); http://hmmer.org/
|
||||
# Copyright (C) 2010 Howard Hughes Medical Institute.
|
||||
# Freely distributed under the GNU General Public License (GPLv3).
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
# query sequence file: mult.fasta
|
||||
# target HMM database: /home/bow/db/hmmer/Pfam-A.hmm
|
||||
# output directed to file: hmmer_cases/text_hmmscan_mult.out
|
||||
# per-seq hits tabular output: hmmer_cases/tab_hmmscan_mult.out
|
||||
# per-dom hits tabular output: hmmer_cases/domtab_hmmscan_mult.out
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
|
||||
Query: gi|4885477|ref|NP_005359.1| [L=154]
|
||||
Description: myoglobin [Homo sapiens]
|
||||
Scores for complete sequence (score includes all domains):
|
||||
--- full sequence --- --- best 1 domain --- -#dom-
|
||||
E-value score bias E-value score bias exp N Model Description
|
||||
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
|
||||
6e-21 74.6 0.3 9.2e-21 74.0 0.2 1.3 1 Globin Globin
|
||||
|
||||
|
||||
Domain annotation for each model (and alignments):
|
||||
>> Globin Globin
|
||||
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
|
||||
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
|
||||
1 ! 74.0 0.2 6.7e-25 9.2e-21 1 107 [. 7 112 .. 7 113 .. 0.97
|
||||
|
||||
Alignments for each domain:
|
||||
== domain 1 score: 74.0 bits; conditional E-value: 6.7e-25
|
||||
HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHSGGGGGGGCCCTTTT.HHHHHTSCHHHHHHHHHHHHHHHHHHCTTSHHHHHH CS
|
||||
Globin 1 qkalvkaswekvkanaeeigaeilkrlfkaypdtkklFkkfgdls.aedlksspkfkahakkvlaaldeavknldnddnlka 81
|
||||
+++lv w+kv+a+++ +g+e+l rlfk +p+t ++F kf+ l+ +++k s+++k+h+++vl al+ ++k+ ++ ++a
|
||||
gi|4885477|ref|NP_005359.1| 7 EWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKsEDEMKASEDLKKHGATVLTALGGILKK---KGHHEA 85
|
||||
5789*********************************************************************...6899** PP
|
||||
|
||||
HHHHHHHHHHTT-.--HHHHCCHHHHH CS
|
||||
Globin 82 alkklgarHakrg.vdpanfklfgeal 107
|
||||
++k l+++Ha+++ ++ ++ + ++e++
|
||||
gi|4885477|ref|NP_005359.1| 86 EIKPLAQSHATKHkIPVKYLEFISECI 112
|
||||
*********************999998 PP
|
||||
|
||||
|
||||
|
||||
Internal pipeline statistics summary:
|
||||
-------------------------------------
|
||||
Query sequence(s): 1 (154 residues)
|
||||
Target model(s): 13672 (2396357 nodes)
|
||||
Passed MSV filter: 458 (0.0334991); expected 273.4 (0.02)
|
||||
Passed bias filter: 404 (0.0295494); expected 273.4 (0.02)
|
||||
Passed Vit filter: 31 (0.00226741); expected 13.7 (0.001)
|
||||
Passed Fwd filter: 1 (7.31422e-05); expected 0.1 (1e-05)
|
||||
Initial search space (Z): 13672 [actual number of targets]
|
||||
Domain search space (domZ): 1 [number of targets reported over threshold]
|
||||
# CPU time: 0.33u 0.16s 00:00:00.49 Elapsed: 00:00:00.21
|
||||
# Mc/sec: 1757.33
|
||||
//
|
||||
"""
|
||||
self.check_raw(filename, "gi|4885477|ref|NP_005359.1|", raw)
|
||||
|
||||
def test_hmmer3text_30_multiple_last(self):
|
||||
"""Test hmmer3-text raw string retrieval, HMMER 3.0, multiple queries, last (text_30_hmmscan_001.out)"""
|
||||
filename = 'Hmmer/text_30_hmmscan_001.out'
|
||||
raw = """# hmmscan :: search sequence(s) against a profile database
|
||||
# HMMER 3.0 (March 2010); http://hmmer.org/
|
||||
# Copyright (C) 2010 Howard Hughes Medical Institute.
|
||||
# Freely distributed under the GNU General Public License (GPLv3).
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
# query sequence file: mult.fasta
|
||||
# target HMM database: /home/bow/db/hmmer/Pfam-A.hmm
|
||||
# output directed to file: hmmer_cases/text_hmmscan_mult.out
|
||||
# per-seq hits tabular output: hmmer_cases/tab_hmmscan_mult.out
|
||||
# per-dom hits tabular output: hmmer_cases/domtab_hmmscan_mult.out
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
|
||||
Query: gi|125490392|ref|NP_038661.2| [L=352]
|
||||
Description: POU domain, class 5, transcription factor 1 isoform 1 [Mus musculus]
|
||||
Scores for complete sequence (score includes all domains):
|
||||
--- full sequence --- --- best 1 domain --- -#dom-
|
||||
E-value score bias E-value score bias exp N Model Description
|
||||
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
|
||||
7e-37 124.8 0.5 1.4e-36 123.9 0.3 1.5 1 Pou Pou domain - N-terminal to homeobox domain
|
||||
2.1e-18 65.5 1.1 4.1e-18 64.6 0.7 1.5 1 Homeobox Homeobox domain
|
||||
------ inclusion threshold ------
|
||||
0.012 15.6 0.0 0.16 12.0 0.0 2.2 2 HTH_31 Helix-turn-helix domain
|
||||
0.039 13.5 0.0 0.095 12.3 0.0 1.6 1 Homeobox_KN Homeobox KN domain
|
||||
0.14 10.5 0.1 0.26 9.6 0.1 1.4 1 DUF521 Protein of unknown function (DUF521)
|
||||
|
||||
|
||||
Domain annotation for each model (and alignments):
|
||||
>> Pou Pou domain - N-terminal to homeobox domain
|
||||
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
|
||||
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
|
||||
1 ! 123.9 0.3 5e-40 1.4e-36 3 75 .] 133 205 .. 131 205 .. 0.97
|
||||
|
||||
Alignments for each domain:
|
||||
== domain 1 score: 123.9 bits; conditional E-value: 5e-40
|
||||
Pou 3 eldleeleefakefkqrrikLgltqadvgsalgalyGkefsqttIcrFEalqLslknmckLkpllekWLeeae 75
|
||||
++ ++ele+fak +kq+ri+Lg+tqadvg +lg+l+Gk+fsqttIcrFEalqLslknmckL+pllekW+eea+
|
||||
gi|125490392|ref|NP_038661.2| 133 KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEAD 205
|
||||
67899******************************************************************96 PP
|
||||
|
||||
>> Homeobox Homeobox domain
|
||||
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
|
||||
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
|
||||
1 ! 64.6 0.7 1.5e-21 4.1e-18 1 57 [] 224 280 .. 224 280 .. 0.98
|
||||
|
||||
Alignments for each domain:
|
||||
== domain 1 score: 64.6 bits; conditional E-value: 1.5e-21
|
||||
SS--SS--HHHHHHHHHHCCTSSS--HHHHHHHHHH----HHHHHHHHHHHHHHHHH CS
|
||||
Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
|
||||
+rkRt++++ Le +F k+++ps ++++++A++lgL++++V+vWF+NrR+k k+
|
||||
gi|125490392|ref|NP_038661.2| 224 KRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKR 280
|
||||
79****************************************************997 PP
|
||||
|
||||
>> HTH_31 Helix-turn-helix domain
|
||||
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
|
||||
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
|
||||
1 ? 12.0 0.0 5.7e-05 0.16 1 35 [. 141 181 .. 141 184 .. 0.96
|
||||
2 ? 0.8 0.0 0.19 5.2e+02 39 62 .. 245 268 .. 243 270 .. 0.86
|
||||
|
||||
Alignments for each domain:
|
||||
== domain 1 score: 12.0 bits; conditional E-value: 5.7e-05
|
||||
HTH_31 1 aLGarLralReraGLtqeevAerlg......vSastlsrlE 35
|
||||
+++ +L++ R + G tq++v+ lg +S++t++r E
|
||||
gi|125490392|ref|NP_038661.2| 141 QFAKLLKQKRITLGYTQADVGLTLGvlfgkvFSQTTICRFE 181
|
||||
6999***********************************99 PP
|
||||
|
||||
== domain 2 score: 0.8 bits; conditional E-value: 0.19
|
||||
HTH_31 39 rgrpsaavlaalaralgldpaera 62
|
||||
++ ps+++++ +a+ lgl+ + ++
|
||||
gi|125490392|ref|NP_038661.2| 245 CPKPSLQQITHIANQLGLEKDVVR 268
|
||||
678**************9988765 PP
|
||||
|
||||
>> Homeobox_KN Homeobox KN domain
|
||||
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
|
||||
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
|
||||
1 ? 12.3 0.0 3.5e-05 0.095 7 39 .. 244 276 .. 241 277 .. 0.91
|
||||
|
||||
Alignments for each domain:
|
||||
== domain 1 score: 12.3 bits; conditional E-value: 3.5e-05
|
||||
Homeobox_KN 7 hnPYPskevkeelakqTglsrkqidnWFiNaRr 39
|
||||
+ P Ps +++ +a+q gl + + WF N R
|
||||
gi|125490392|ref|NP_038661.2| 244 KCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQ 276
|
||||
56779*************************996 PP
|
||||
|
||||
>> DUF521 Protein of unknown function (DUF521)
|
||||
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
|
||||
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
|
||||
1 ? 9.6 0.1 9.4e-05 0.26 273 334 .. 221 280 .. 197 294 .. 0.77
|
||||
|
||||
Alignments for each domain:
|
||||
== domain 1 score: 9.6 bits; conditional E-value: 9.4e-05
|
||||
DUF521 273 adlaavleelnkakkeevdlvvlGcPhlsleeleelaellkgrkkkvsvelvvttsravlsk 334
|
||||
+ +++ + +++++ +++ ++l cP sl++++++a++l +k v+++ + r+ ++
|
||||
gi|125490392|ref|NP_038661.2| 221 QARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEK--DVVRVWFCNRRQKGKR 280
|
||||
345666667778888899************************99..9999999988876554 PP
|
||||
|
||||
|
||||
|
||||
Internal pipeline statistics summary:
|
||||
-------------------------------------
|
||||
Query sequence(s): 1 (352 residues)
|
||||
Target model(s): 13672 (2396357 nodes)
|
||||
Passed MSV filter: 603 (0.0441047); expected 273.4 (0.02)
|
||||
Passed bias filter: 465 (0.0340111); expected 273.4 (0.02)
|
||||
Passed Vit filter: 44 (0.00321826); expected 13.7 (0.001)
|
||||
Passed Fwd filter: 5 (0.000365711); expected 0.1 (1e-05)
|
||||
Initial search space (Z): 13672 [actual number of targets]
|
||||
Domain search space (domZ): 5 [number of targets reported over threshold]
|
||||
# CPU time: 0.51u 0.15s 00:00:00.66 Elapsed: 00:00:00.23
|
||||
# Mc/sec: 3667.47
|
||||
//
|
||||
"""
|
||||
self.check_raw(filename, "gi|125490392|ref|NP_038661.2|", raw)
|
||||
|
||||
def test_hmmer3text_30_single(self):
|
||||
"""Test hmmer3-text raw string retrieval, HMMER 3.0, single query (text_30_hmmscan_003.out)"""
|
||||
filename = 'Hmmer/text_30_hmmscan_003.out'
|
||||
raw = """# hmmscan :: search sequence(s) against a profile database
|
||||
# HMMER 3.0 (March 2010); http://hmmer.org/
|
||||
# Copyright (C) 2010 Howard Hughes Medical Institute.
|
||||
# Freely distributed under the GNU General Public License (GPLv3).
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
# query sequence file: s01.fasta
|
||||
# target HMM database: /home/bow/db/hmmer/Pfam-A.hmm
|
||||
# output directed to file: hmmer_cases/text_hmmscan_s01.out
|
||||
# per-seq hits tabular output: hmmer_cases/tab_hmmscan_s01.out
|
||||
# per-dom hits tabular output: hmmer_cases/domtab_hmmscan_s01.out
|
||||
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
|
||||
|
||||
Query: gi|4885477|ref|NP_005359.1| [L=154]
|
||||
Description: myoglobin [Homo sapiens]
|
||||
Scores for complete sequence (score includes all domains):
|
||||
--- full sequence --- --- best 1 domain --- -#dom-
|
||||
E-value score bias E-value score bias exp N Model Description
|
||||
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
|
||||
6e-21 74.6 0.3 9.2e-21 74.0 0.2 1.3 1 Globin Globin
|
||||
|
||||
|
||||
Domain annotation for each model (and alignments):
|
||||
>> Globin Globin
|
||||
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
|
||||
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
|
||||
1 ! 74.0 0.2 6.7e-25 9.2e-21 1 107 [. 7 112 .. 7 113 .. 0.97
|
||||
|
||||
Alignments for each domain:
|
||||
== domain 1 score: 74.0 bits; conditional E-value: 6.7e-25
|
||||
HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHSGGGGGGGCCCTTTT.HHHHHTSCHHHHHHHHHHHHHHHHHHCTTSHHHHHH CS
|
||||
Globin 1 qkalvkaswekvkanaeeigaeilkrlfkaypdtkklFkkfgdls.aedlksspkfkahakkvlaaldeavknldnddnlka 81
|
||||
+++lv w+kv+a+++ +g+e+l rlfk +p+t ++F kf+ l+ +++k s+++k+h+++vl al+ ++k+ ++ ++a
|
||||
gi|4885477|ref|NP_005359.1| 7 EWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKsEDEMKASEDLKKHGATVLTALGGILKK---KGHHEA 85
|
||||
5789*********************************************************************...6899** PP
|
||||
|
||||
HHHHHHHHHHTT-.--HHHHCCHHHHH CS
|
||||
Globin 82 alkklgarHakrg.vdpanfklfgeal 107
|
||||
++k l+++Ha+++ ++ ++ + ++e++
|
||||
gi|4885477|ref|NP_005359.1| 86 EIKPLAQSHATKHkIPVKYLEFISECI 112
|
||||
*********************999998 PP
|
||||
|
||||
|
||||
|
||||
Internal pipeline statistics summary:
|
||||
-------------------------------------
|
||||
Query sequence(s): 1 (154 residues)
|
||||
Target model(s): 13672 (2396357 nodes)
|
||||
Passed MSV filter: 458 (0.0334991); expected 273.4 (0.02)
|
||||
Passed bias filter: 404 (0.0295494); expected 273.4 (0.02)
|
||||
Passed Vit filter: 31 (0.00226741); expected 13.7 (0.001)
|
||||
Passed Fwd filter: 1 (7.31422e-05); expected 0.1 (1e-05)
|
||||
Initial search space (Z): 13672 [actual number of targets]
|
||||
Domain search space (domZ): 1 [number of targets reported over threshold]
|
||||
# CPU time: 0.28u 0.17s 00:00:00.45 Elapsed: 00:00:00.21
|
||||
# Mc/sec: 1757.33
|
||||
//
|
||||
"""
|
||||
self.check_raw(filename, "gi|4885477|ref|NP_005359.1|", raw)
|
||||
|
||||
|
||||
class Hmmer3TextIndexCases(CheckIndex):
|
||||
|
||||
fmt = 'hmmer3-text'
|
||||
|
||||
def test_hmmertext_text_30_hmmscan_001(self):
|
||||
"""Test hmmer3-text indexing, HMMER 3.0, multiple queries"""
|
||||
filename = 'Hmmer/text_30_hmmscan_001.out'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmertext_text_30_hmmscan_002(self):
|
||||
"""Test hmmer3-text indexing, HMMER 3.0, single query, no hits"""
|
||||
filename = 'Hmmer/text_30_hmmscan_002.out'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmertext_text_30_hmmscan_006(self):
|
||||
"""Test hmmer3-text indexing, HMMER 3.0, single query, multiple hits"""
|
||||
filename = 'Hmmer/text_30_hmmscan_006.out'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmertext_text_30_hmmscan_007(self):
|
||||
"""Test hmmer3-text indexing, HMMER 3.0, single query, no alignments"""
|
||||
filename = 'Hmmer/text_30_hmmscan_007.out'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmertext_text_30_hmmscan_008(self):
|
||||
"""Test hmmer3-text indexing, HMMER 3.0, single query, no alignment width"""
|
||||
filename = 'Hmmer/text_30_hmmscan_008.out'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
def test_hmmertext_text_30_hmmsearch_005(self):
|
||||
"""Test hmmer3-text indexing, HMMER 3.0, multiple queries"""
|
||||
filename = 'Hmmer/text_30_hmmsearch_005.out'
|
||||
self.check_index(filename, self.fmt)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
runner = unittest.TextTestRunner(verbosity = 2)
|
||||
unittest.main(testRunner=runner)
|
File diff suppressed because it is too large
Load Diff
Reference in New Issue
Block a user